SLC35B2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC35B2 Antibody [NBP1-80641] - Staining of human gall bladder shows strong membrane positivity in glandular cells.

• Reactivity: Hu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC35B2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC35B2 Antibody - BSA Free (NBP1-80641) is a polyclonal antibody validated for use in IHC. Anti-SLC35B2 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC35B2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC35B2 Protein (NBP1-80641PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC35B2 Antibody - BSA Free

• adenosine 3'-phospho 5'-phosphosulfate transporter 1
• PAPS transporter 1
• PAPST13'-phosphoadenosine 5'-phosphosulfate transporter
• Putative MAPK-activating protein PM15
• Putative NF-kappa-B-activating protein 48
• SLL
• solute carrier family 35 member B2 variant 2
• Solute carrier family 35 member B2
• solute carrier family 35, member B2
• UGTrel4

Background

Sulfotransferases (e.g., SULT4A1; MIM 608359) use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen (Kamiyama et al., 2003 [PubMed 12716889]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC35B2 Antibody (NBP1-80641)(2)

Publications using NBP1-80641

• Zhu J, Fan Y, Xiong Y et al. Delineating the dynamic evolution from preneoplasia to invasive lung adenocarcinoma by integrating single-cell RNA sequencing and spatial transcriptomics Experimental & molecular medicine 2022-11-25 [PMID: 36434043] (IF/IHC, Human)
• Stirling ER, Terabe M, Wilson AS et al. Targeting the CD47/thrombospondin-1 signaling axis regulates immune cell bioenergetics in the tumor microenvironment to potentiate antitumor immune response Journal for immunotherapy of cancer 2022-11-01 [PMID: 36418073] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: SLC35B2
• Entrez:
  • 347734(Human)