CXCR3 Antibody - BSA Free

Immunohistochemistry-Paraffin: CXCR3 Antibody [NBP2-38547] - Analysis in human lymph node and cerebral cortex tissues using NBP2-38547 antibody. Corresponding CXCR3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CXCR3 Antibody [NBP2-38547] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: CXCR3 Antibody [NBP2-38547] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: CXCR3 Antibody [NBP2-38547] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: CXCR3 Antibody [NBP2-38547] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CXCR3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CXCR3 Antibody - BSA Free (NBP2-38547) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CXCR3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CXCR3 Protein (NBP2-38547PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CXCR3 Antibody - BSA Free

• CD183 antigen
• CD183
• chemokine (C-X-C motif) receptor 3
• chemokine (C-X-C) receptor 3
• CKR-L2IP-10 receptor
• CMKAR3
• C-X-C chemokine receptor type 3
• CXCR3
• CXC-R3
• CXCR-3
• G protein-coupled receptor 9CD182
• GPR9
• GPR9Mig-R
• Interferon-inducible protein 10 receptor
• IP10 receptor
• IP10-R
• Mig receptor
• MigR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CXCR3
• Uniprot:
  • P49682()