Reactivity | HuSpecies Glossary |
Applications | ICC/IF |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CX3CR1 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for CX3CR1 Antibody (NBP2-69050)Discover more about diseases related to CX3CR1 Antibody (NBP2-69050).
| Pathways for CX3CR1 Antibody (NBP2-69050)View related products by pathway.
|
PTMs for CX3CR1 Antibody (NBP2-69050)Learn more about PTMs related to CX3CR1 Antibody (NBP2-69050).
| Research Areas for CX3CR1 Antibody (NBP2-69050)Find related products by research area.
|
TMEM 119 is a specific marker of microglia cells By Jennifer Sokolowski, MD, PhD.Microglia are a major immune-cell component in the brain. They ingest and degrade dead cells, debris, and foreign material and interact with other immune cells to orchestrate centra... Read full blog post. |
New Study Links Tau Mutations to Microglial Immune Response Tau proteins are abundant in the axons of neurons in the central nervous system (CNS), and play a key role in microtubule formation and stabilization. Antibody studies have identified six tau isoforms, all produced by alternative mRNA splicing of the ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CX3CR1 |