CX3CR1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CX3CR1 Antibody [NBP2-69050] - Staining of human cell line HEL shows localization to nucleus. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CX3CR1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CX3CR1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
CX3CR1 Recombinant Protein Antigen (NBP2-69050PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for CX3CR1 Antibody

  • Beta chemokine receptor-like 1
  • CCRL1
  • chemokine (C-C) receptor-like 1
  • chemokine (C-X3-C motif) receptor 1
  • chemokine (C-X3-C) receptor 1
  • CMKbRL1
  • CMK-BRL1
  • CMK-BRL-1
  • CMKDR1
  • CX3C chemokine receptor 1
  • CX3CR1
  • Fractalkine receptor
  • G protein-coupled receptor 13
  • GPR13G-protein coupled receptor 13
  • GPRV28
  • V28
  • V28C-X3-C CKR-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35334
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
DCP00
Species: Hu
Applications: ELISA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DRN00B
Species: Hu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DY417
Species: Mu
Applications: ELISA
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
7268-CT
Species: Hu
Applications: BA
MAB160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
D6050
Species: Hu
Applications: ELISA
MAB145
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
MAB155
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP2-69050
Species: Hu
Applications: ICC/IF

Publications for CX3CR1 Antibody (NBP2-69050) (0)

There are no publications for CX3CR1 Antibody (NBP2-69050).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CX3CR1 Antibody (NBP2-69050) (0)

There are no reviews for CX3CR1 Antibody (NBP2-69050). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CX3CR1 Antibody (NBP2-69050) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CX3CR1 Products

Bioinformatics Tool for CX3CR1 Antibody (NBP2-69050)

Discover related pathways, diseases and genes to CX3CR1 Antibody (NBP2-69050). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CX3CR1 Antibody (NBP2-69050)

Discover more about diseases related to CX3CR1 Antibody (NBP2-69050).
 

Pathways for CX3CR1 Antibody (NBP2-69050)

View related products by pathway.

PTMs for CX3CR1 Antibody (NBP2-69050)

Learn more about PTMs related to CX3CR1 Antibody (NBP2-69050).
 

Research Areas for CX3CR1 Antibody (NBP2-69050)

Find related products by research area.

Blogs on CX3CR1.

TMEM 119 is a specific marker of microglia cells
By Jennifer Sokolowski, MD, PhD.Microglia are a major immune-cell component in the brain. They ingest and degrade dead cells, debris, and foreign material and interact with other immune cells to orchestrate centra...  Read full blog post.

New Study Links Tau Mutations to Microglial Immune Response
Tau proteins are abundant in the axons of neurons in the central nervous system (CNS), and play a key role in microtubule formation and stabilization. Antibody studies have identified six tau isoforms, all produced by alternative mRNA splicing of the ...  Read full blog post.

Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CX3CR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CX3CR1