CSRP3 Antibody


Western Blot: CSRP3 Antibody [NBP2-13880] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP2-13880] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP2-13880] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP2-13880] - Staining in human heart muscle and prostate tissues using anti-CSRP3 antibody. Corresponding CSRP3 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CSRP3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGK SVYA
Specificity of human CSRP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CSRP3 Protein (NBP2-13880PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CSRP3 Antibody

  • Cardiac LIM protein
  • CLPMGC14488
  • CMD1Mcardiac LIM domain protein
  • CMH12
  • CRP3cysteine and glycine-rich protein 3
  • cysteine and glycine-rich protein 3 (cardiac LIM protein)
  • Cysteine-rich protein 3
  • LIM domain only 4
  • LIM domain protein, cardiac
  • LMO4
  • MLPMGC61993
  • Muscle LIM protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CSRP3 Antibody (NBP2-13880) (0)

There are no publications for CSRP3 Antibody (NBP2-13880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSRP3 Antibody (NBP2-13880) (0)

There are no reviews for CSRP3 Antibody (NBP2-13880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSRP3 Antibody (NBP2-13880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CSRP3 Products

Bioinformatics Tool for CSRP3 Antibody (NBP2-13880)

Discover related pathways, diseases and genes to CSRP3 Antibody (NBP2-13880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSRP3 Antibody (NBP2-13880)

Discover more about diseases related to CSRP3 Antibody (NBP2-13880).

Pathways for CSRP3 Antibody (NBP2-13880)

View related products by pathway.

PTMs for CSRP3 Antibody (NBP2-13880)

Learn more about PTMs related to CSRP3 Antibody (NBP2-13880).

Research Areas for CSRP3 Antibody (NBP2-13880)

Find related products by research area.

Blogs on CSRP3

There are no specific blogs for CSRP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CSRP3 Antibody and receive a gift card or discount.


Gene Symbol CSRP3