CSRP3 Antibody


Western Blot: CSRP3 Antibody [NBP2-13880] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP2-13880] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Reactivity Hu, Mouse, RatSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

CSRP3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGK SVYA
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
CSRP3 Protein (NBP2-13880PEP)

Alternate Names for CSRP3 Antibody

  • Cardiac LIM protein
  • CLPMGC14488
  • CMD1Mcardiac LIM domain protein
  • CMH12
  • CRP3cysteine and glycine-rich protein 3
  • cysteine and glycine-rich protein 3 (cardiac LIM protein)
  • Cysteine-rich protein 3
  • LIM domain only 4
  • LIM domain protein, cardiac
  • LMO4
  • MLPMGC61993
  • Muscle LIM protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Fe, Fi, Rb, Xp
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: Flow, ICC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Applications: Func-Inh
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mouse, Rat
Applications: WB, IHC, IHC-P

Publications for CSRP3 Antibody (NBP2-13880) (0)

There are no publications for CSRP3 Antibody (NBP2-13880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSRP3 Antibody (NBP2-13880) (0)

There are no reviews for CSRP3 Antibody (NBP2-13880). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSRP3 Antibody (NBP2-13880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CSRP3 Antibody Products

Related Products by Gene

Bioinformatics Tool for CSRP3 Antibody (NBP2-13880)

Discover related pathways, diseases and genes to CSRP3 Antibody (NBP2-13880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSRP3 Antibody (NBP2-13880)

Discover more about diseases related to CSRP3 Antibody (NBP2-13880).

Pathways for CSRP3 Antibody (NBP2-13880)

View related products by pathway.

PTMs for CSRP3 Antibody (NBP2-13880)

Learn more about PTMs related to CSRP3 Antibody (NBP2-13880).

Research Areas for CSRP3 Antibody (NBP2-13880)

Find related products by research area.

Blogs on CSRP3

There are no specific blogs for CSRP3, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol CSRP3

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-13880 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought