CLPP Antibody

Images

 
Western Blot: CLPP Antibody [NBP1-89557] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-CLPP antibody. Remaining relative intensity is presented. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: CLPP Antibody [NBP1-89557] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
Western Blot: CLPP Antibody [NBP1-89557] - Analysis in human cell line HEK 293.
Western Blot: CLPP Antibody [NBP1-89557] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLPP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLPP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CLPP Recombinant Protein Antigen (NBP1-89557PEP)
Publications
Read Publications using NBP1-89557.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22361696)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLPP Antibody

  • ATP-dependent protease ClpAP, proteolytic subunit, human
  • ClpP (caseinolytic protease, ATP-dependent, proteolytic subunit, E. coli)homolog
  • ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E.coli)
  • ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog (E.coli)
  • ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog
  • EC 3.4.21.92
  • Endopeptidase Clp
  • putative ATP-dependent Clp protease proteolytic subunit, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89478
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54851
Species: Hu
Applications: WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-83703
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16890
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00050945-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-54633
Species: Hu
Applications: WB, IHC
NBP2-57880
Species: Hu
Applications: ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-86109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-49499
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CLPP Antibody (NBP1-89557)(2)

Reviews for CLPP Antibody (NBP1-89557) (0)

There are no reviews for CLPP Antibody (NBP1-89557). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLPP Antibody (NBP1-89557) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLPP Products

Bioinformatics Tool for CLPP Antibody (NBP1-89557)

Discover related pathways, diseases and genes to CLPP Antibody (NBP1-89557). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLPP Antibody (NBP1-89557)

Discover more about diseases related to CLPP Antibody (NBP1-89557).
 

Pathways for CLPP Antibody (NBP1-89557)

View related products by pathway.

PTMs for CLPP Antibody (NBP1-89557)

Learn more about PTMs related to CLPP Antibody (NBP1-89557).
 

Research Areas for CLPP Antibody (NBP1-89557)

Find related products by research area.

Blogs on CLPP

There are no specific blogs for CLPP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLPP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLPP