CS Citrate Synthase Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody [NBP2-13877] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13877] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13877] - Staining of human colon shows strong cytoplasmic positivity, seen with a granular pattern, in glandular cells.

Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13877] - Staining of human heart muscle shows high expression.

Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13877] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13877] - Staining in human heart muscle and pancreas tissues using anti-CS antibody. Corresponding CS RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13877] - Staining of human cerebral cortex, heart muscle, kidney and pancreas using Anti-CS antibody NBP2-13877 (A) shows similar protein distribution across tissues to independent antibody NBP2-13878 (B).

Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13877] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CS Citrate Synthase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CS Citrate Synthase Antibody - BSA Free (NBP2-13877) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVS
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  CS Citrate Synthase Protein (NBP2-13877PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CS Citrate Synthase Antibody - BSA Free

• citrate (Si)-synthase
• citrate synthase
• citrate synthase, mitochondrial
• CS Citrate Synthase
• EC 2.3.3
• EC 2.3.3.1

Background

The protein encoded by the CS Citrate Synthase gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citratefrom oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metablism. Thisprotein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CS