Peripherin 2/PRPH2 Antibody

Images

 
Western Blot: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Analysis in control (vector only transfected HEK293T lysate) and PRPH2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Peripherin 2/PRPH2 Antibody [NBP1-86687] - Staining of human eye, retina shows moderate cytoplasmic positivity in photoreceptor cells

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Peripherin 2/PRPH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSLENTLGQGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQITNNSAHYSYDHQTEELNLWVR
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRPH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Peripherin 2/PRPH2 Protein (NBP1-86687PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Peripherin 2/PRPH2 Antibody

  • AOFMD
  • AVMD
  • CACD2
  • CACD2peripherin 2, homolog of mouse
  • DS
  • peripherin 2 (retinal degeneration, slow)
  • Peripherin 2
  • peripherin-2
  • PRPH2
  • PRPHperipherin, photoreceptor type
  • rd2
  • RDS
  • Retinal degeneration slow protein
  • retinal degeneration, slow
  • retinal peripherin
  • RP7
  • Tetraspanin-22
  • TSPAN22
  • tspan-22
  • TSPAN22retinal degeneration, slow (retinitis pigmentosa 7)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF143
Species: Hu
Applications: IHC, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
DNST0
Species: Hu
Applications: ELISA
NBP1-84732
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
664-LI/CF
Species: Hu
Applications: BA
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
D6050
Species: Hu
Applications: ELISA
NBP1-86687
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Peripherin 2/PRPH2 Antibody (NBP1-86687) (0)

There are no publications for Peripherin 2/PRPH2 Antibody (NBP1-86687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peripherin 2/PRPH2 Antibody (NBP1-86687) (0)

There are no reviews for Peripherin 2/PRPH2 Antibody (NBP1-86687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peripherin 2/PRPH2 Antibody (NBP1-86687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Peripherin 2/PRPH2 Products

Bioinformatics Tool for Peripherin 2/PRPH2 Antibody (NBP1-86687)

Discover related pathways, diseases and genes to Peripherin 2/PRPH2 Antibody (NBP1-86687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peripherin 2/PRPH2 Antibody (NBP1-86687)

Discover more about diseases related to Peripherin 2/PRPH2 Antibody (NBP1-86687).
 

Pathways for Peripherin 2/PRPH2 Antibody (NBP1-86687)

View related products by pathway.

Blogs on Peripherin 2/PRPH2

There are no specific blogs for Peripherin 2/PRPH2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peripherin 2/PRPH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPH2