Dehydrodolichyl Diphosphate Synthase Antibody

Images

 
Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human epididymis shows strong positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dehydrodolichyl Diphosphate Synthase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHDDS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Dehydrodolichyl Diphosphate Synthase Protein (NBP1-87964PEP)
Publications
Read Publication using NBP1-87964.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dehydrodolichyl Diphosphate Synthase Antibody

  • cis-isoprenyltransferase
  • cis-prenyl transferase
  • CIT
  • CPT
  • Dedol-PP synthase
  • dehydrodolichyl diphosphate synthase
  • EC 2.5.1.-
  • FLJ13102
  • HDSDS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00007150-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964)(1)

Reviews for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964) (0)

There are no reviews for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dehydrodolichyl Diphosphate Synthase Products

Bioinformatics Tool for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964)

Discover related pathways, diseases and genes to Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964)

Discover more about diseases related to Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964).
 

Pathways for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964)

View related products by pathway.

PTMs for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964)

Learn more about PTMs related to Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964).

Blogs on Dehydrodolichyl Diphosphate Synthase

There are no specific blogs for Dehydrodolichyl Diphosphate Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dehydrodolichyl Diphosphate Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHDDS