Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Epididymis shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Kidney shows strong membranous and cytoplasmic positivity in cells in tubules and glomeruli.

Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Rectum shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-87964] - Staining of human Testis shows strong membranous and cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHDDS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Dehydrodolichyl Diphosphate Synthase Protein (NBP1-87964PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Dehydrodolichyl Diphosphate Synthase Antibody - BSA Free

• cis-isoprenyltransferase
• cis-prenyl transferase
• CIT
• CPT
• Dedol-PP synthase
• dehydrodolichyl diphosphate synthase
• EC 2.5.1.-
• FLJ13102
• HDSDS

Background

Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dehydrodolichyl Diphosphate Synthase Antibody (NBP1-87964)(1)

Publication using NBP1-87964

• Zelinger L, Banin E, Obolensky A et al. A missense mutation in DHDDS, encoding dehydrodolichyl diphosphate synthase, is associated with autosomal-recessive retinitis pigmentosa in Ashkenazi Jews. Am J Hum Genet 2011-02-01 [PMID: 21295282]

Bioinformatics

• Gene Symbol: DHDDS