Coactosin-like Protein 1/CotL1 Antibody


Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851] - Analysis of HeLa cell lysate (30ug) using anti-COTL1 antibody. Image from verified customer review.
Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP1-54851] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Eq, RbSpecies Glossary
Applications WB

Order Details

Coactosin-like Protein 1/CotL1 Antibody Summary

Synthetic peptides corresponding to COTL1(coactosin-like 1 (Dictyostelium)) The peptide sequence was selected from the N terminal of COTL1. Peptide sequence MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Equine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against COTL1 and was validated on Western blot.
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
NBP1-54851 in the following application:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Coactosin-like Protein 1/CotL1 Antibody

  • CLP
  • CLPFLJ43657
  • Coactosin like Protein 1
  • coactosin-like 1 (Dictyostelium)
  • Coactosin-like Protein 1
  • coactosin-like protein
  • COTL1
  • MGC19733


This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, PAGE, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Species: Hu, RM
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Eq, Rb
Applications: WB

Publications for Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851) (0)

There are no publications for Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-54851:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Coactosin-like Protein 1/CotL1 NBP1-54851
reviewed by:
WB Human 10/07/2014


ApplicationWestern Blot
Sample TestedHela Cell Lysate


Blocking DetailsBSA (5%) in PBS buffer

Primary Anitbody

Dilution Ratio1:800 diluted in PBS buffer

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP conjugated secondary antibody (Biopioneer)
Secondary Manufacturer Cat#GAR21002-1
Secondary Concentration1:15000


Detection NotesDeveloped using FemtoLucent Plus HRP Chemiluminescent Kit with a 1 min exposure

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Coactosin-like Protein 1/CotL1 Products

Bioinformatics Tool for Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851)

Discover related pathways, diseases and genes to Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851)

Discover more about diseases related to Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851).

Pathways for Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851)

View related products by pathway.

PTMs for Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851)

Learn more about PTMs related to Coactosin-like Protein 1/CotL1 Antibody (NBP1-54851).

Blogs on Coactosin-like Protein 1/CotL1

There are no specific blogs for Coactosin-like Protein 1/CotL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol COTL1