CLEC16A Antibody


Western Blot: CLEC16A Antibody [NBP2-57150] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: CLEC16A Antibody [NBP2-57150] - Staining of human cell line A549 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

CLEC16A Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRALNITIHKP
Specificity of human CLEC16A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CLEC16A Recombinant Protein Antigen (NBP2-57150PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CLEC16A Antibody

  • C-type lectin domain family 16, member A
  • KIAA0350Gop-1
  • MGC111457
  • protein CLEC16A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Ca
Applications: Flow, IP, B/N
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Neut
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC

Publications for CLEC16A Antibody (NBP2-57150) (0)

There are no publications for CLEC16A Antibody (NBP2-57150).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLEC16A Antibody (NBP2-57150) (0)

There are no reviews for CLEC16A Antibody (NBP2-57150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLEC16A Antibody (NBP2-57150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CLEC16A Antibody (NBP2-57150)

Discover related pathways, diseases and genes to CLEC16A Antibody (NBP2-57150). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLEC16A Antibody (NBP2-57150)

Discover more about diseases related to CLEC16A Antibody (NBP2-57150).

Pathways for CLEC16A Antibody (NBP2-57150)

View related products by pathway.

PTMs for CLEC16A Antibody (NBP2-57150)

Learn more about PTMs related to CLEC16A Antibody (NBP2-57150).

Research Areas for CLEC16A Antibody (NBP2-57150)

Find related products by research area.

Blogs on CLEC16A

There are no specific blogs for CLEC16A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CLEC16A Antibody and receive a gift card or discount.


Gene Symbol CLEC16A