EVI5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EVI5 Antibody [NBP1-82596] - Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: EVI5 Antibody [NBP1-82596] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EVI5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EVI5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EVI5 Protein (NBP1-82596PEP)
Publications
Read Publication using
NBP1-82596 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse, Human reactivity reported in scientific literature (PMID: 23910958). Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EVI5 Antibody

  • dJ846D11.1 (ecotropic viral integration site 5)
  • ecotropic viral integration site 5 protein homolog
  • ecotropic viral integration site 5
  • EVI-5
  • NB4SNeuroblastoma stage 4S gene protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NBP1-54654
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84850
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57150
Species: Hu
Applications: WB, ICC/IF
H00009098-M01
Species: Hu
Applications: WB, ELISA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82596
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for EVI5 Antibody (NBP1-82596)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for EVI5 Antibody (NBP1-82596) (0)

There are no reviews for EVI5 Antibody (NBP1-82596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EVI5 Antibody (NBP1-82596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EVI5 Products

Bioinformatics Tool for EVI5 Antibody (NBP1-82596)

Discover related pathways, diseases and genes to EVI5 Antibody (NBP1-82596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EVI5 Antibody (NBP1-82596)

Discover more about diseases related to EVI5 Antibody (NBP1-82596).
 

Pathways for EVI5 Antibody (NBP1-82596)

View related products by pathway.

PTMs for EVI5 Antibody (NBP1-82596)

Learn more about PTMs related to EVI5 Antibody (NBP1-82596).

Blogs on EVI5

There are no specific blogs for EVI5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EVI5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EVI5