Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8)

Western Blot: Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) [NBP3-15389] - Analysis of extracts of various cell lines, using Chymase/CMA1/Mast Cell Chymase (CMA1) Rabbit mAb (NBP3-15389) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) [NBP3-15389] - Human appendix using Chymase/CMA1/Mast Cell Chymase (CMA1) Rabbit mAb (NBP3-15389) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 2O4P8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) Summary

• Description: Novus Biologicals Rabbit Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8) (NBP3-15389) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CMA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Chymase/CMA1/Mast Cell Chymase Antibody (2O4P8)

• Alpha-chymase
• chymase 1 preproprotein transcript E
• chymase 1 preproprotein transcript I
• chymase 1, mast cell
• Chymase
• chymase, heart
• chymase, mast cell
• CMA1
• CYH
• CYM
• EC 3.4.21
• EC 3.4.21.39
• Mast cell protease I
• MCP3P
• Mcpt5
• MCT1
• MGC119890
• MGC119891

Background

Mast cells contain a number of preformed chemicals mediators such as histamine, chymase, carboxypeptidase and proteolytic tryptase. Human Mast Cell Chymase is considered to be an important marker of mast cells as well as an important mediator of inflammation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CMA1