CHPT1 Antibody - Azide and BSA Free

Images

 
Western Blot: CHPT1 Antibody [NBP2-92299] - Analysis of extracts of DU145 cells, using CHPT1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25 ug per lane. ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CHPT1 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHPT1 (NP_064629.2). MAAGAGAGSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHPT1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:2000
Reviewed Applications
Read 1 Review rated 1
using
NBP2-92299 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.3, 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for CHPT1 Antibody - Azide and BSA Free

  • AAPT1-like protein
  • choline phosphotransferase 1
  • cholinephosphotransferase 1 alpha
  • CPT
  • CPT1cholinephosphotransferase 1
  • Diacylglycerol cholinephosphotransferase 1
  • EC 2.7.8
  • EC 2.7.8.2
  • hCPT1
  • phosphatidylcholine synthesizing enzyme

Background

CHPT1 catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highlyelectrophilic allylic isomer, dimethylallyl diphosphate (DMAPP)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CHPT1 Antibody (NBP2-92299) (0)

There are no publications for CHPT1 Antibody (NBP2-92299).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CHPT1 Antibody (NBP2-92299) (1) 11

Average Rating: 1
(Based on 1 review)
We have 1 review tested in 1 species: Human and Mouse.

Reviews using NBP2-92299:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CHPT1 NBP2-92299
Enlarge
1
reviewed by:
Hua Jiang
WB Human and Mouse 02/02/2021
View

Summary

ApplicationWestern Blot
Sample TestedLiver,spleen
SpeciesHuman and Mouse
Lot1162780101

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHPT1 Antibody (NBP2-92299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHPT1 Products

Array NBP2-92299

Research Areas for CHPT1 Antibody (NBP2-92299)

Find related products by research area.

Blogs on CHPT1

There are no specific blogs for CHPT1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

1
5
0
4
0
3
0
2
0
1
1

Hua Jiang
02/02/2021
Application: WB
Species: Human and Mouse

Bioinformatics

Gene Symbol CHPT1