Topoisomerase I Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Analysis in human placenta and skeletal muscle tissues. Corresponding TOP1 RNA-seq data are presented for the same ...read more
Western Blot: Topoisomerase I Antibody [NBP1-90365] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Topoisomerase I Antibody [NBP1-90365] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: Topoisomerase I Antibody [NBP1-90365] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human lymphoid tissues shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human placenta shows very strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Func, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Topoisomerase I Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Proximity Ligation Assay -Reported in scientific literature (PMID:35013124).
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Topoisomerase I Protein (NBP1-90365PEP)
Publications
Read Publication using
NBP1-90365 in the following applications:

  • 1 publication
  • PLA
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Topoisomerase I Antibody

  • DNA topoisomerase 1
  • DNA topoisomerase I
  • EC 5.6.2.1
  • EC 5.99.1.2
  • TOP1
  • TOPI
  • topoisomerase (DNA) I
  • Topoisomerase I
  • type I DNA topoisomerase

Background

Topoisomerases are nuclear enzymes involved in a variety of cellular activities such as chromosome condensation, DNA replication, transcription, recombination and segregation at mitosis. Human topoisomerase I is a 100kD protein capable of relaxing positively and negatively supercoiled DNA by performing a transient single stranded nick which is then religated at the end of the reaction. It has been shown that the enzyme is located in regions of the genome that are undergoing active RNA synthesis, where it probably reduces superhelical stresses in the DNA, enabling RNA polymerase to function properly. Both DNA topoisomerases I and II have been found to be targets of autoantibodies in the sera of patients with certain autoimmune diseases such as systemic lupus erythematosus and also of some anti tumor drugs and antibiotics. Elevated levels of DNA topoisomerase I, detected by transfer assays, have been demonstrated in colorectal tumors compared with normal colon mucosa as a result of increased transcription or mRNA stability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Topoisomerase I Antibody (NBP1-90365)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, PLA, WB.


Filter By Application
ICC/IF
(1)
PLA
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Topoisomerase I Antibody (NBP1-90365) (0)

There are no reviews for Topoisomerase I Antibody (NBP1-90365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Topoisomerase I Antibody (NBP1-90365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Topoisomerase I Products

Research Areas for Topoisomerase I Antibody (NBP1-90365)

Find related products by research area.

Blogs on Topoisomerase I

There are no specific blogs for Topoisomerase I, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Topoisomerase I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOP1