Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Analysis in human placenta and skeletal muscle tissues. Corresponding TOP1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human placenta shows very strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human lymphoid tissues shows strong nuclear positivity in germinal center cells.
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Novus Biologicals Rabbit Topoisomerase I Antibody - BSA Free (NBP1-90365) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Topoisomerase I Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Topoisomerase I Antibody - BSA Free
DNA topoisomerase 1
DNA topoisomerase I
EC 5.6.2.1
EC 5.99.1.2
TOP1
TOPI
topoisomerase (DNA) I
Topoisomerase I
type I DNA topoisomerase
Background
Topoisomerases are nuclear enzymes involved in a variety of cellular activities such as chromosome condensation, DNA replication, transcription, recombination and segregation at mitosis. Human topoisomerase I is a 100kD protein capable of relaxing positively and negatively supercoiled DNA by performing a transient single stranded nick which is then religated at the end of the reaction. It has been shown that the enzyme is located in regions of the genome that are undergoing active RNA synthesis, where it probably reduces superhelical stresses in the DNA, enabling RNA polymerase to function properly. Both DNA topoisomerases I and II have been found to be targets of autoantibodies in the sera of patients with certain autoimmune diseases such as systemic lupus erythematosus and also of some anti tumor drugs and antibiotics. Elevated levels of DNA topoisomerase I, detected by transfer assays, have been demonstrated in colorectal tumors compared with normal colon mucosa as a result of increased transcription or mRNA stability.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Topoisomerase I Antibody (NBP1-90365) (0)
There are no reviews for Topoisomerase I Antibody (NBP1-90365).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Topoisomerase I Antibody - BSA Free and receive a gift card or discount.