Topoisomerase I Antibody


Western Blot: Topoisomerase I Antibody [NBP1-90365] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Topoisomerase I Antibody [NBP1-90365] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human appendix shows general nuclear positivity.
Western Blot: Topoisomerase I Antibody [NBP1-90365] - Analysis in human cell line HELA.
Immunocytochemistry/ Immunofluorescence: Topoisomerase I Antibody [NBP1-90365] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Topoisomerase I Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Topoisomerase I Protein (NBP1-90365PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Topoisomerase I Antibody

  • DNA topoisomerase 1
  • DNA topoisomerase I
  • EC
  • TOPI
  • topoisomerase (DNA) I
  • type I DNA topoisomerase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IP
Species: Hu
Applications: IHC
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Topoisomerase I Antibody (NBP1-90365) (0)

There are no publications for Topoisomerase I Antibody (NBP1-90365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Topoisomerase I Antibody (NBP1-90365) (0)

There are no reviews for Topoisomerase I Antibody (NBP1-90365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Topoisomerase I Antibody (NBP1-90365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Topoisomerase I Products

Bioinformatics Tool for Topoisomerase I Antibody (NBP1-90365)

Discover related pathways, diseases and genes to Topoisomerase I Antibody (NBP1-90365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Topoisomerase I Antibody (NBP1-90365)

Discover more about diseases related to Topoisomerase I Antibody (NBP1-90365).

Pathways for Topoisomerase I Antibody (NBP1-90365)

View related products by pathway.

PTMs for Topoisomerase I Antibody (NBP1-90365)

Learn more about PTMs related to Topoisomerase I Antibody (NBP1-90365).

Research Areas for Topoisomerase I Antibody (NBP1-90365)

Find related products by research area.

Blogs on Topoisomerase I

There are no specific blogs for Topoisomerase I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Topoisomerase I Antibody and receive a gift card or discount.


Gene Symbol TOP1