Topoisomerase I Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Analysis in human placenta and skeletal muscle tissues. Corresponding TOP1 RNA-seq data are presented for the same ...read more
Western Blot: Topoisomerase I Antibody [NBP1-90365] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Topoisomerase I Antibody [NBP1-90365] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: Topoisomerase I Antibody [NBP1-90365] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human lymphoid tissues shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human placenta shows very strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Topoisomerase I Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Proximity Ligation Assay
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Use in Proximity Ligation Assay reported in scientific literature (PMID:35013124) For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Topoisomerase I Protein (NBP1-90365PEP)
Publications
Read Publication using
NBP1-90365 in the following applications:

  • 1 publication
  • PLA
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Topoisomerase I Antibody

  • DNA topoisomerase 1
  • DNA topoisomerase I
  • EC 5.99.1.2
  • TOPI
  • topoisomerase (DNA) I
  • type I DNA topoisomerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87964
Species: Hu
Applications: IHC, IHC-P
NBP2-92299
Species: Hu
Applications: WB
NB100-81642
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-86928
Species: Hu
Applications: IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP2-67219
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD, WB
NBP2-66958
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PLA

Publications for Topoisomerase I Antibody (NBP1-90365)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, PLA, WB.


Filter By Application
ICC/IF
(1)
PLA
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Topoisomerase I Antibody (NBP1-90365) (0)

There are no reviews for Topoisomerase I Antibody (NBP1-90365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Topoisomerase I Antibody (NBP1-90365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Topoisomerase I Products

Bioinformatics Tool for Topoisomerase I Antibody (NBP1-90365)

Discover related pathways, diseases and genes to Topoisomerase I Antibody (NBP1-90365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Topoisomerase I Antibody (NBP1-90365)

Discover more about diseases related to Topoisomerase I Antibody (NBP1-90365).
 

Pathways for Topoisomerase I Antibody (NBP1-90365)

View related products by pathway.

PTMs for Topoisomerase I Antibody (NBP1-90365)

Learn more about PTMs related to Topoisomerase I Antibody (NBP1-90365).
 

Research Areas for Topoisomerase I Antibody (NBP1-90365)

Find related products by research area.

Blogs on Topoisomerase I

There are no specific blogs for Topoisomerase I, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Topoisomerase I Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOP1