CDP/CUTL1 Antibody

Images

 
Western Blot: CDP/CUTL1 Antibody [NBP2-13883] - Analysis in human thyroid gland tissue.
Immunocytochemistry/ Immunofluorescence: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human cell line MCF7 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Frozen: CDP/CUTL1 Antibody [NBP2-13883] - P15 mouse brain stained with CUTL1 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human Fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDP/CUTL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSFQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQR LHDIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQA ETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALE
Specificity
Specificity of human CDP/CUTL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CUX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. CDP/CUTL1 antibody validated for IHC-F from a verified customer review.
Control Peptide
CDP/CUTL1 Protein (NBP2-13883PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP2-13883 in the following applications:

Publications
Read Publication using NBP2-13883.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27471254).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDP/CUTL1 Antibody

  • CASP
  • CCAAT displacement protein
  • CDP
  • CDP/Cux
  • CDPCCAAT displacement protein
  • COY1
  • cut (Drosophila)-like 1 (CCAAT displacement protein)
  • CUT
  • CUTL1
  • cut-like 1, CCAAT displacement protein (Drosophila)
  • cut-like homeobox 1
  • CUX
  • CUX1
  • FLJ31745
  • golgi integral membrane protein 6
  • GOLIM6
  • homeobox protein cut-like 1
  • Homeobox protein cux-1
  • Nbla10317
  • p100
  • p110
  • p200
  • p75
  • protein CASP
  • putative protein product of Nbla10317

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-67375
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-67329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC, KO
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94064
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P, KD
MAB3468
Species: Hu
Applications: WB, ICC
NBP2-13883
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for CDP/CUTL1 Antibody (NBP2-13883)(1)

We have publications tested in 1 confirmed species: Mouse.


Filter By Application
All Applications
Filter By Species
Mouse
(1)
All Species

Review for CDP/CUTL1 Antibody (NBP2-13883) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-13883:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen CDP/CUTL1 NBP2-13883
Enlarge
4
reviewed by:
Anonymous
IHC-Fr Mouse 03/13/2016
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedP15 Mouse Brain
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDP/CUTL1 Antibody (NBP2-13883) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CDP/CUTL1 Products

Bioinformatics Tool for CDP/CUTL1 Antibody (NBP2-13883)

Discover related pathways, diseases and genes to CDP/CUTL1 Antibody (NBP2-13883). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDP/CUTL1 Antibody (NBP2-13883)

Discover more about diseases related to CDP/CUTL1 Antibody (NBP2-13883).
 

Pathways for CDP/CUTL1 Antibody (NBP2-13883)

View related products by pathway.

PTMs for CDP/CUTL1 Antibody (NBP2-13883)

Learn more about PTMs related to CDP/CUTL1 Antibody (NBP2-13883).

Blogs on CDP/CUTL1

There are no specific blogs for CDP/CUTL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
03/13/2016
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol CUX1