CDP/CUTL1 Antibody

Images

 
Western Blot: CDP/CUTL1 Antibody [NBP2-13883] - Analysis in human thyroid gland tissue.
Immunocytochemistry/ Immunofluorescence: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human cell line MCF7 shows localization to nucleoplasm and the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Frozen: CDP/CUTL1 Antibody [NBP2-13883] - P15 mouse brain stained with CUTL1 antibody. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody [NBP2-13883] - Staining of human Fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDP/CUTL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSFQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQR LHDIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQA ETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALE
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CUX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Microarray
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. CDP/CUTL1 antibody is validated for IHC-F and microarray from verified customer reviews.
Control Peptide
CDP/CUTL1 Protein (NBP2-13883PEP)
Reviewed Applications
Read 2 Reviews rated 3.5
using
NBP2-13883 in the following applications:

Publications
Read Publications using
NBP2-13883 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27471254) and verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDP/CUTL1 Antibody

  • CASP
  • CCAAT displacement protein
  • CDP
  • CDP/Cux
  • CDPCCAAT displacement protein
  • COY1
  • cut (Drosophila)-like 1 (CCAAT displacement protein)
  • CUT
  • CUTL1
  • cut-like 1, CCAAT displacement protein (Drosophila)
  • cut-like homeobox 1
  • CUX
  • CUX1
  • FLJ31745
  • golgi integral membrane protein 6
  • GOLIM6
  • homeobox protein cut-like 1
  • Homeobox protein cux-1
  • Nbla10317
  • p100
  • p110
  • p200
  • p75
  • protein CASP
  • putative protein product of Nbla10317

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Ca, Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
DBD00
Species: Hu
Applications: ELISA
DRT100
Species: Hu
Applications: ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
DR2A00
Species: Hu
Applications: ELISA
AF175
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP2-67329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91887
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00004354-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP1-87801
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
202-IL
Species: Hu
Applications: BA
256-GF
Species: Hu
Applications: BA
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
MAB3468
Species: Hu
Applications: ICC, WB
NBP2-13883
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr

Publications for CDP/CUTL1 Antibody (NBP2-13883)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for CDP/CUTL1 Antibody (NBP2-13883) (2) 3.52

Average Rating: 3.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP2-13883:
Filter by Applications
MiAr
(1)
IHC-Fr
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Microarray CDP/CUTL1 NBP2-13883
Enlarge
3
reviewed by:
Verified Customer
MiAr Human 12/07/2020
View

Summary

ApplicationMicroarray
Sample TestedEDTA Plasma
SpeciesHuman
LotA107051
Immunohistochemistry-Frozen CDP/CUTL1 NBP2-13883
Enlarge
4
reviewed by:
Verified Customer
IHC-Fr Mouse 03/13/2016
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedP15 Mouse Brain
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDP/CUTL1 Antibody (NBP2-13883) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CDP/CUTL1 Products

Bioinformatics Tool for CDP/CUTL1 Antibody (NBP2-13883)

Discover related pathways, diseases and genes to CDP/CUTL1 Antibody (NBP2-13883). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDP/CUTL1 Antibody (NBP2-13883)

Discover more about diseases related to CDP/CUTL1 Antibody (NBP2-13883).
 

Pathways for CDP/CUTL1 Antibody (NBP2-13883)

View related products by pathway.

PTMs for CDP/CUTL1 Antibody (NBP2-13883)

Learn more about PTMs related to CDP/CUTL1 Antibody (NBP2-13883).

Blogs on CDP/CUTL1

There are no specific blogs for CDP/CUTL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3.5
5
0
4
1
3
1
2
0
1
0

Verified Customer
12/07/2020
Application: MiAr
Species: Human

Verified Customer
03/13/2016
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol CUX1