ARHGEF7 Antibody

Images

 
Western Blot: ARHGEF7 Antibody [NBP1-88650] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ARHGEF7 Antibody [NBP1-88650] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGEF7 Protein (NBP1-88650PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF7 Antibody

  • Beta-Pix
  • COOL1COOL-1
  • DKFZp686C12170
  • DKFZp761K1021
  • guanine nucleotide exchange factor 7
  • KIAA0142KIAA0412
  • Nbla10314
  • P50
  • P50BP
  • P85
  • P85COOL1
  • P85SPRBETA-PIX
  • PAK3
  • PAK3BP
  • PIXBPAK-interacting exchange factor beta
  • Rho guanine nucleotide exchange factor (GEF) 7
  • rho guanine nucleotide exchange factor 7
  • SH3 domain-containing proline-rich protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ARHGEF7 Antibody (NBP1-88650) (0)

There are no publications for ARHGEF7 Antibody (NBP1-88650).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF7 Antibody (NBP1-88650) (0)

There are no reviews for ARHGEF7 Antibody (NBP1-88650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGEF7 Antibody (NBP1-88650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF7 Products

Bioinformatics Tool for ARHGEF7 Antibody (NBP1-88650)

Discover related pathways, diseases and genes to ARHGEF7 Antibody (NBP1-88650). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF7 Antibody (NBP1-88650)

Discover more about diseases related to ARHGEF7 Antibody (NBP1-88650).
 

Pathways for ARHGEF7 Antibody (NBP1-88650)

View related products by pathway.

PTMs for ARHGEF7 Antibody (NBP1-88650)

Learn more about PTMs related to ARHGEF7 Antibody (NBP1-88650).

Blogs on ARHGEF7

There are no specific blogs for ARHGEF7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF7
Entrez
Uniprot