CD63 Antibody

Images

 
Immunohistochemistry-Paraffin: CD63 Antibody [NBP1-82784] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: CD63 Antibody [NBP1-82784] - Staining of human bone marrow shows moderate to strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: CD63 Antibody [NBP1-82784] - Staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: CD63 Antibody [NBP1-82784] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD63 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG
Marker
Late Endosomes Marker
Specificity
Specificity of human CD63 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD63
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD63 Recombinant Protein Antigen (NBP1-82784PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD63 Antibody

  • CD63 antigen (melanoma 1 antigen)
  • CD63 antigen
  • CD63 molecule
  • CD63
  • Granulophysin
  • Lamp-3
  • Lysosomal-associated membrane protein 3
  • ME491
  • melanoma 1 antigen
  • Melanoma-associated antigen ME491
  • melanoma-associated antigen MLA1
  • MLA1lysosome-associated membrane glycoprotein 3
  • Ocular melanoma-associated antigen
  • OMA81H
  • tetraspanin-30
  • Tspan30
  • tspan-30
  • TSPAN30granulophysin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88928
Species: Hu
Applications: IHC, IHC-P
MAB4609
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP1-84581
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB500-393
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IP, CyTOF-ready
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
NBP2-33820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NBP1-82784
Species: Hu
Applications: IHC, IHC-P

Publications for CD63 Antibody (NBP1-82784) (0)

There are no publications for CD63 Antibody (NBP1-82784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD63 Antibody (NBP1-82784) (0)

There are no reviews for CD63 Antibody (NBP1-82784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD63 Antibody (NBP1-82784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CD63 Antibody (NBP1-82784)

Discover related pathways, diseases and genes to CD63 Antibody (NBP1-82784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD63 Antibody (NBP1-82784)

Discover more about diseases related to CD63 Antibody (NBP1-82784).
 

Pathways for CD63 Antibody (NBP1-82784)

View related products by pathway.

PTMs for CD63 Antibody (NBP1-82784)

Learn more about PTMs related to CD63 Antibody (NBP1-82784).
 

Research Areas for CD63 Antibody (NBP1-82784)

Find related products by research area.

Blogs on CD63.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD63 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD63
Entrez