CD40 Ligand/TNFSF5 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CD40LG |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CD40 Ligand/TNFSF5 Antibody - BSA Free
Background
CD40L is the ligand for CD40, a member of the tumor necrosis factor (TNF) receptor superfamily. CD40L is expressed mainly on activated CD4+ T-lymphocytes as a single-pass type II membrane protein. Proteolytic processing of the membrane form results in a soluble secreted form of CD40L.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Publications for CD40 Ligand/TNFSF5 Antibody (NBP3-16982) (0)
There are no publications for CD40 Ligand/TNFSF5 Antibody (NBP3-16982).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD40 Ligand/TNFSF5 Antibody (NBP3-16982) (0)
There are no reviews for CD40 Ligand/TNFSF5 Antibody (NBP3-16982).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CD40 Ligand/TNFSF5 Antibody (NBP3-16982). (Showing 1 - 1 of 1 FAQ).
-
I am looking for paired ABs for use in detecting CD40L (rat) by ELISA. Do you have such a reagent(s) available?
- Unfortunately we currently do not have any CD40 Ligand antibody pairs that have been validated in Rat. The only antibody pairs we offer for CD40L are validated in Human. I apologize for this inconvenience. If you would be interested in testing one of our products in Rat I'd like to invite you to participate in our Innovators Reward Program. Please contact us at innovators@novusbio.com with any questions regarding this program.
Secondary Antibodies
| |
Isotype Controls
|
Additional CD40 Ligand/TNFSF5 Products
Research Areas for CD40 Ligand/TNFSF5 Antibody (NBP3-16982)
Find related products by research area.
|
Blogs on CD40 Ligand/TNFSF5