CCR7 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: CCR7 Antibody [NBP2-57375] - Staining of human cell line A549 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CCR7 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCR7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCR7 Recombinant Protein Antigen (NBP2-57375PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CCR7 Antibody - BSA Free

  • BLR2
  • BLR2C-C chemokine receptor type 7
  • C-C CKR-7
  • CC-CKR-7
  • CCR7
  • CCR-7
  • CD197 antigen
  • CD197
  • CDw197
  • CDw197CC chemokine receptor 7
  • chemokine (C-C motif) receptor 7
  • CMKBR7
  • CMKBR7chemokine (C-C) receptor 7
  • EBI1
  • EBI1EBV-induced G protein-coupled receptor 1
  • EBV-induced G-protein coupled receptor 1
  • Epstein-Barr virus induced gene 1
  • Epstein-Barr virus induced G-protein coupled receptor
  • Epstein-Barr virus-induced G-protein coupled receptor 1
  • EVI1
  • lymphocyte-specific G protein-coupled peptide receptor
  • MIP-3 beta receptor

Background

Chemokine receptor 7 (CCR7) is a G-protein coupled receptor (GPCR) that binds chemokine ligand 19 (CCL19) and chemokine ligand 21 (CCL21) and, together, this receptor-ligand interaction functions in inflammatory and adaptive immune response (1,2). The CCR7 protein contains 7-transmembrane spanning alpha helices and is 378 amino acids (aa) in length, with a theoretical molecular weight of 42.8 kDa (3,4). CCR7 is expressed on several cells within the immune system, including naive T cells, central memory T cells, regulatory T cells, naive B cells, a subset of double negative and single positive thymocytes, and mature dendritic cells (DCs) (1, 3).

The primary role of the CCR7/CCL19/CCL21 chemokine signaling axis is homing T cells and DCs to lymph nodes and lymphoid tissues to initiate an immune response (1,2,5,6). In the context of cancer, the CCR7 signaling axis appears to have two opposing roles (2). Downregulation of CCR7 on CD8+ T cells contributes to effector cell migration and anti-cancer activities via cytotoxic tumor-infiltrating lymphocytes (2). However, upregulation of CCR7 by cancer cells can result in cancer cell migration and metastasis (2). Overexpression of CCR7 has been implicated in a variety of cancers including breast, cervical, gastric, head and neck cell carcinoma, and prostate (1,2,7). Studies in breast cancer have found that hypoxia increases CCR7 expression, and this activation can affect cancer cell invasion, extravasation, proliferation, angiogenesis, and metastasis through induction of multiple signaling transduction pathways such as PI3K/AKT, MAPK, and JAK/STAT (5,7).

Given its important role in inflammation and immune response, several strategies have been employed to target the CCR7 signaling axis for cancer immunotherapy (2). Some cancer immunotherapies under investigation include intra-tumoral administration of CCL19 and CCL21, introduction of patient-derived cells transfected to express CCR7 or its ligands, and vaccines (2). Further interrogation of CCR7/CCL19/CCL21 signaling axis is required to develop better therapeutic strategies for cancer treatment.

References:

1. Comerford, I., Harata-Lee, Y., Bunting, M. D., Gregor, C., Kara, E. E., & McColl, S. R. (2013). A myriad of functions and complex regulation of the CCR7/CCL19/CCL21 chemokine axis in the adaptive immune system. Cytokine & growth factor reviews, 24(3), 269-283. https://doi.org/10.1016/j.cytogfr.2013.03.001

2. Salem, A., Alotaibi, M., Mroueh, R., Basheer, H. A., & Afarinkia, K. (2021). CCR7 as a therapeutic target in Cancer. Biochimica et biophysica acta. Reviews on cancer, 1875(1), 188499. https://doi.org/10.1016/j.bbcan.2020.188499

3. Yan, Y., Chen, R., Wang, X., Hu, K., Huang, L., Lu, M., & Hu, Q. (2019). CCL19 and CCR7 Expression, Signaling Pathways, and Adjuvant Functions in Viral Infection and Prevention. Frontiers in cell and developmental biology, 7, 212. https://doi.org/10.3389/fcell.2019.00212

4. Uniprot (P32248)

5. Korbecki, J., Grochans, S., Gutowska, I., Barczak, K., & Baranowska-Bosiacka, I. (2020). CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of Receptors CCR5, CCR6, CCR7, CCR8, CCR9, and CCR10 Ligands. International journal of molecular sciences, 21(20), 7619. https://doi.org/10.3390/ijms21207619

6. Sanchez-Sanchez, N., Riol-Blanco, L., & Rodriguez-Fernandez, J. L. (2006). The multiple personalities of the chemokine receptor CCR7 in dendritic cells. Journal of immunology (Baltimore, Md. : 1950), 176(9), 5153-5159. https://doi.org/10.4049/jimmunol.176.9.5153

7. Rizeq, B., & Malki, M. I. (2020). The Role of CCL21/CCR7 Chemokine Axis in Breast Cancer Progression. Cancers, 12(4), 1036. https://doi.org/10.3390/cancers12041036

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

366-6C
Species: Hu
Applications: BA
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
361-MI
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
7268-CT
Species: Hu
Applications: BA
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
DY417
Species: Mu
Applications: ELISA
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-48848
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
202-IL
Species: Hu
Applications: BA
MAB1774
Species: Hu
Applications: CyTOF-ready, Flow, ICC
6507-IL/CF
Species: Hu
Applications: BA
NBP2-57375
Species: Hu
Applications: ICC/IF

Publications for CCR7 Antibody (NBP2-57375) (0)

There are no publications for CCR7 Antibody (NBP2-57375).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCR7 Antibody (NBP2-57375) (0)

There are no reviews for CCR7 Antibody (NBP2-57375). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCR7 Antibody (NBP2-57375) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCR7 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CCR7