CCR3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit CCR3 Antibody - BSA Free (NBP3-21328) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YETEELFEETLCSALYPEDTVYSWRHFHTLRMTI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CCR3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CCR3 Antibody - BSA Free
Background
CKR3, or C-C chemokine receptor type 3, is a G protein-coupled, seven-transmembrane domain receptor protein. The chemokine eotaxin appears to be a highly specific agonist for CKR3, making CKR3 one of the factors responsible for selective recruitment of eosinophils to sites of inflammation (1). It has been shown that more than one chemokine activates CKR3, including eotaxin, RANTES, and MCP-3 (2). Since CKR3 is prominently expressed in eosinophils , it has been named the human eosinophil eotaxin receptor (2,3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Mu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: Neut, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ICC/IF
Publications for CCR3 Antibody (NBP3-21328) (0)
There are no publications for CCR3 Antibody (NBP3-21328).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCR3 Antibody (NBP3-21328) (0)
There are no reviews for CCR3 Antibody (NBP3-21328).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CCR3 Antibody (NBP3-21328) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCR3 Products
Research Areas for CCR3 Antibody (NBP3-21328)
Find related products by research area.
|
Blogs on CCR3