CCL23/Ck beta 8-1/MIP3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: NPVLLDMLWRRKIGPQMTLSHAAGFHATSADCCISYTPRSIPCSLLESYFETNS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CCL23 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CCL23/Ck beta 8-1/MIP3 Antibody - BSA Free
Background
Macrophage Inflammatory Protein 3, also known as CCL23, is located on the p-arm of chromosome 9 with other CC cytokine genes which are involved in immunoregulatory and inflammatory processes. In patients with rheumatoid arthritis, high levels on CCL23(19-99) have been found in synovial fluids. This protein is known to have interaction with CCR1, CCR10, CCR2, CCR3 and CCR4.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Mu
Applications: CyTOF-ready, IHC, ICFlow, Neut, WB
Species: Hu
Applications: BA, BA
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: ELISA
Publications for CCL23/Ck beta 8-1/MIP3 Antibody (NBP1-88079) (0)
There are no publications for CCL23/Ck beta 8-1/MIP3 Antibody (NBP1-88079).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCL23/Ck beta 8-1/MIP3 Antibody (NBP1-88079) (0)
There are no reviews for CCL23/Ck beta 8-1/MIP3 Antibody (NBP1-88079).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CCL23/Ck beta 8-1/MIP3 Antibody (NBP1-88079) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCL23/Ck beta 8-1/MIP3 Products
Research Areas for CCL23/Ck beta 8-1/MIP3 Antibody (NBP1-88079)
Find related products by research area.
|
Blogs on CCL23/Ck beta 8-1/MIP3