CCL16/HCC-4/LEC Antibody - BSA Free

Western Blot: CCL16/HCC-4/LEC Antibody [NBP1-74186] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CCL16/HCC-4/LEC Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to the N terminal of CCL16. Immunizing peptide sequence SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCL16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 11 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CCL16/HCC-4/LEC Antibody - BSA Free

• C-C motif chemokine 16
• CCL16
• chemokine (C-C motif) ligand 16
• Chemokine CC-4
• Chemokine LEC
• CKb12
• HCC4
• HCC-4
• HCC-4Liver-expressed chemokine
• LCC-1Lymphocyte and monocyte chemoattractant
• LEC
• liver CC chemokine-1
• LMC
• LMCSmall-inducible cytokine A16
• monotactin-1
• Mtn-1
• NCC-4
• NCC4IL-10-inducible chemokine
• NCC-4ILINCK
• new CC chemokine 4
• SCYA16MGC117051
• SCYL4
• small inducible cytokine subfamily A (Cys-Cys), member 16

Background

CCL16 gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL16 displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL16
• Uniprot:
  • O15467()