CCL16/HCC-4/LEC Antibody


Western Blot: CCL16/HCC-4/LEC Antibody [NBP1-74186] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CCL16/HCC-4/LEC Antibody Summary

Synthetic peptides corresponding to the N terminal of CCL16. Immunizing peptide sequence SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CCL16 and was validated on Western blot.
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CCL16/HCC-4/LEC Antibody

  • C-C motif chemokine 16
  • CCL16
  • chemokine (C-C motif) ligand 16
  • Chemokine CC-4
  • Chemokine LEC
  • CKb12
  • HCC4
  • HCC-4
  • HCC-4Liver-expressed chemokine
  • LCC-1Lymphocyte and monocyte chemoattractant
  • LEC
  • liver CC chemokine-1
  • LMC
  • LMCSmall-inducible cytokine A16
  • monotactin-1
  • Mtn-1
  • NCC-4
  • NCC4IL-10-inducible chemokine
  • new CC chemokine 4
  • SCYA16MGC117051
  • SCYL4
  • small inducible cytokine subfamily A (Cys-Cys), member 16


CCL16 gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL16 displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: Flow, CyTOF-ready
Species: Mu, Hu(-)
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Mu
Applications: WB, ELISA, IHC, IHC-P

Publications for CCL16/HCC-4/LEC Antibody (NBP1-74186) (0)

There are no publications for CCL16/HCC-4/LEC Antibody (NBP1-74186).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL16/HCC-4/LEC Antibody (NBP1-74186) (0)

There are no reviews for CCL16/HCC-4/LEC Antibody (NBP1-74186). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCL16/HCC-4/LEC Antibody (NBP1-74186) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCL16/HCC-4/LEC Products

Bioinformatics Tool for CCL16/HCC-4/LEC Antibody (NBP1-74186)

Discover related pathways, diseases and genes to CCL16/HCC-4/LEC Antibody (NBP1-74186). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL16/HCC-4/LEC Antibody (NBP1-74186)

Discover more about diseases related to CCL16/HCC-4/LEC Antibody (NBP1-74186).

Pathways for CCL16/HCC-4/LEC Antibody (NBP1-74186)

View related products by pathway.

PTMs for CCL16/HCC-4/LEC Antibody (NBP1-74186)

Learn more about PTMs related to CCL16/HCC-4/LEC Antibody (NBP1-74186).

Blogs on CCL16/HCC-4/LEC

There are no specific blogs for CCL16/HCC-4/LEC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCL16/HCC-4/LEC Antibody and receive a gift card or discount.


Gene Symbol CCL16