CC Chemokine Receptor D6 Antibody


Western Blot: CC Chemokine Receptor D6 Antibody [NBP1-88150] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate more
Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody [NBP1-88150] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody [NBP1-88150] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: CC Chemokine Receptor D6 Antibody [NBP1-88150] - Staining in human placenta and prostate tissues using anti-ACKR2 antibody. Corresponding ACKR2 RNA-seq data are presented for the same more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CC Chemokine Receptor D6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
Specificity of human CC Chemokine Receptor D6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CC Chemokine Receptor D6 Protein (NBP1-88150PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CC Chemokine Receptor D6 Antibody

  • ACKR2
  • C-C chemokine receptor D6
  • CCBP2
  • CCR10CCR9D6CC-chemokine-binding receptor JAB61
  • chemokine (C-C) receptor 9
  • chemokine binding protein 2
  • Chemokine receptor CCR-10
  • Chemokine receptor CCR-9
  • chemokine receptor D6
  • chemokine-binding protein 2
  • Chemokine-binding protein D6
  • CMKBR9
  • CMKBR9chemokine (C-C motif) receptor 9
  • D6
  • hD6
  • MGC126678
  • MGC138250


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Mu
Applications: WB, Neut
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: Flow, CyTOF-ready
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CC Chemokine Receptor D6 Antibody (NBP1-88150) (0)

There are no publications for CC Chemokine Receptor D6 Antibody (NBP1-88150).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CC Chemokine Receptor D6 Antibody (NBP1-88150) (0)

There are no reviews for CC Chemokine Receptor D6 Antibody (NBP1-88150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CC Chemokine Receptor D6 Antibody (NBP1-88150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CC Chemokine Receptor D6 Products

Bioinformatics Tool for CC Chemokine Receptor D6 Antibody (NBP1-88150)

Discover related pathways, diseases and genes to CC Chemokine Receptor D6 Antibody (NBP1-88150). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CC Chemokine Receptor D6 Antibody (NBP1-88150)

Discover more about diseases related to CC Chemokine Receptor D6 Antibody (NBP1-88150).

Pathways for CC Chemokine Receptor D6 Antibody (NBP1-88150)

View related products by pathway.

PTMs for CC Chemokine Receptor D6 Antibody (NBP1-88150)

Learn more about PTMs related to CC Chemokine Receptor D6 Antibody (NBP1-88150).

Research Areas for CC Chemokine Receptor D6 Antibody (NBP1-88150)

Find related products by research area.

Blogs on CC Chemokine Receptor D6

There are no specific blogs for CC Chemokine Receptor D6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CC Chemokine Receptor D6 Antibody and receive a gift card or discount.


Gene Symbol CCBP2