CBX3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CBX3 Antibody [NBP1-83228] - Staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear bodies.

Immunohistochemistry-Paraffin: CBX3 Antibody [NBP1-83228] - Staining of human testis shows high expression.

Staining of human duodenum shows strong nuclear positivity in glandular cells.

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Staining of human lymph node shows strong nuclear positivity in germinal center cells.

Analysis in human cell line SH-SY5Y.

• Reactivity: Hu, Mu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CBX3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CBX3 Antibody - BSA Free (NBP1-83228) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CBX3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEA
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBX3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CBX3 Protein (NBP1-83228PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35417713). Reactivity reported in scientific literature (PMID: 23409045).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CBX3 Antibody - BSA Free

• chromobox homolog 3 (Drosophila HP1 gamma)
• chromobox homolog 3
• chromobox protein homolog 3
• Drosophila)
• HECH
• Heterochromatin protein 1 homolog gamma
• heterochromatin protein HP1 gamma
• heterochromatin-like protein 1
• HP1 gamma homolog
• HP1 gamma
• HP1-GAMMA
• Modifier 2 protein

Background

HP1 gamma appears to be involved in transcriptional silencing in heterochromatin-like complexes. It recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. HP1 gamma may contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR) and involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CBX3 Antibody (NBP1-83228)(2)

Publications using NBP1-83228

• Liu H, Giffen KP, Chen L et al. Molecular and cytological profiling of biological aging of mouse cochlear inner and outer hair cells Cell reports 2022-04-12 [PMID: 35417713] (IF/IHC, Mouse)
• Yan L, Xing Z, Guo Z et al. Somatostatin Derivative (smsDX) Targets Cellular Metabolism in Prostate Cancer Cells after Androgen Deprivation Therapy. PLoS One 2013-01-01 [PMID: 23409045]

Bioinformatics

• Gene Symbol: CBX3