Cathepsin E Antibody

Images

 
Western Blot: Cathepsin E Antibody [NBP2-33868] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cathepsin E Antibody [NBP2-33868] - Staining in human stomach and liver tissues using anti-CTSE antibody. Corresponding CTSE RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: Cathepsin E Antibody [NBP2-33868] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Cathepsin E Antibody [NBP2-33868] - Staining of human stomach shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Cathepsin E Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTSE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cathepsin E Protein (NBP2-33868PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cathepsin E Antibody

  • CATE
  • Cathepsin E
  • CTSE
  • EC 3.4.23
  • EC 3.4.23.34
  • erythrocyte membrane aspartic proteinase
  • slow-moving proteinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP1-91011
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-24916
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
AF953
Species: Hu
Applications: IHC, IP, KO, Simple Western, WB
NB600-922
Species: Ch, V-Vi
Applications: ELISA, IHC, IHC-P, IP, Single-Cell Western, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-22217
Species: Ch, Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
375-TL
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
DY417
Species: Mu
Applications: ELISA
NBP2-52721
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Cathepsin E Antibody (NBP2-33868) (0)

There are no publications for Cathepsin E Antibody (NBP2-33868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin E Antibody (NBP2-33868) (0)

There are no reviews for Cathepsin E Antibody (NBP2-33868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin E Antibody (NBP2-33868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cathepsin E Products

Bioinformatics Tool for Cathepsin E Antibody (NBP2-33868)

Discover related pathways, diseases and genes to Cathepsin E Antibody (NBP2-33868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin E Antibody (NBP2-33868)

Discover more about diseases related to Cathepsin E Antibody (NBP2-33868).
 

Pathways for Cathepsin E Antibody (NBP2-33868)

View related products by pathway.

PTMs for Cathepsin E Antibody (NBP2-33868)

Learn more about PTMs related to Cathepsin E Antibody (NBP2-33868).
 

Research Areas for Cathepsin E Antibody (NBP2-33868)

Find related products by research area.

Blogs on Cathepsin E

There are no specific blogs for Cathepsin E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSE
Uniprot