CASZ1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CASZ1 Antibody [NBP1-86617] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CASZ1 Antibody [NBP1-86617] - Staining of human skin shows strong nuclear positivity in stratum granulosum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CASZ1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYEEYIRKLKAGEQLSWPAPSTKTEERVGKE
Specificity
Specificity of human CASZ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CASZ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CASZ1 Recombinant Protein Antigen (NBP1-86617PEP)
Publications
Read Publication using
NBP1-86617 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CASZ1 Antibody

  • castor homolog 1, zinc finger (Drosophila)
  • castor homolog 1, zinc finger
  • castor zinc finger 1
  • castor
  • Castor-related protein
  • CST
  • dJ734G22.1
  • FLJ20321
  • Putative survival-related protein
  • SRG
  • SRGcst
  • survival related
  • survival-related
  • Zinc finger protein 693
  • zinc finger protein castor homolog 1
  • ZNF693
  • ZNF693FLJ12223

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69148
Species: Hu, Rt
Applications: WB, ELISA
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
MAB5826
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NB110-75035
Species: Hu, Mu, Ha(-)
Applications: WB, ICC/IF, IHC, KD, Single-Cell Western
NBP2-16655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CASZ1 Antibody (NBP1-86617)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CASZ1 Antibody (NBP1-86617) (0)

There are no reviews for CASZ1 Antibody (NBP1-86617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CASZ1 Antibody (NBP1-86617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CASZ1 Products

Bioinformatics Tool for CASZ1 Antibody (NBP1-86617)

Discover related pathways, diseases and genes to CASZ1 Antibody (NBP1-86617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CASZ1 Antibody (NBP1-86617)

Discover more about diseases related to CASZ1 Antibody (NBP1-86617).
 

Pathways for CASZ1 Antibody (NBP1-86617)

View related products by pathway.

PTMs for CASZ1 Antibody (NBP1-86617)

Learn more about PTMs related to CASZ1 Antibody (NBP1-86617).

Blogs on CASZ1

There are no specific blogs for CASZ1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CASZ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASZ1