CARD11/CARMA1 Antibody (8N4C9)

Western Blot: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Western blot analysis of extracts of various cell lines, using CARD11/CARMA1 Rabbit mAb (NBP3-16849) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Immunofluorescence analysis of mouse spleen using CARD11/CARMA1 Rabbit mAb (NBP3-16849) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Immunohistochemistry of paraffin-embedded rat spleen using CARD11/CARMA1 Rabbit mAb (NBP3-16849) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Immunohistochemistry of paraffin-embedded mouse spleen using CARD11/CARMA1 Rabbit mAb (NBP3-16849) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Immunofluorescence analysis of rat spleen using CARD11/CARMA1 Rabbit mAb (NBP3-16849) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Immunofluorescence analysis of paraffin-embedded mouse spleen using CARD11/CARMA1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: CARD11/CARMA1 Antibody (8N4C9) [NBP3-16849] - Immunofluorescence analysis of paraffin-embedded rat spleen using CARD11/CARMA1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: CARD11/CARMA1 Antibody (8N4C9) [CARD11/CARMA1] - Immunofluorescence analysis of paraffin-embedded rat spleen using CARD11/CARMA1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 8N4C9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CARD11/CARMA1 Antibody (8N4C9) Summary

• Description: Novus Biologicals Rabbit CARD11/CARMA1 Antibody (8N4C9) (NBP3-16849) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1055-1154 of human CARD11/CARMA1 (Q9BXL7). EAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CARD11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 133 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CARD11/CARMA1 Antibody (8N4C9)

• BIMP3
• BIMP3card-maguk protein 1
• CARD11
• CARD-containing MAGUK protein 1
• Carma 1
• CARMA1
• CARMA1bcl10-interacting maguk protein 3
• caspase recruitment domain family, member 11
• caspase recruitment domain-containing protein 11
• MGC133069

Background

CARD11 belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein has a domain structure similar to that of CARD14 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CARD11