We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

C-Reactive Protein/CRP Antibody - BSA Free

Images

 
Independent Antibodies: Western Blot: C-Reactive Protein/CRP Antibody [NBP1-87184] - Analysis using Anti-CRP antibody NBP1-87184 (A) shows similar pattern to independent antibody NBP1-87183 (B).
Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87184] - Staining of human tonsil shows no cytoplasmic positivity as expected.
Western Blot: C-Reactive Protein/CRP Antibody [NBP1-87184] - Analysis in human plasma.
Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87184] - Staining of human duodenum shows moderate positivity in plasma in blood vessels.
Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87184] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
 

Independent Antibodies

       

Order Details

View Available Formulations
Catalog# & Formulation Size Price

C-Reactive Protein/CRP Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C-Reactive Protein/CRP Protein (NBP1-87184PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for C-Reactive Protein/CRP Antibody - BSA Free

  • C-Reactive Protein
  • C-reactive protein, pentraxin-related
  • CRP
  • MGC88244
  • pentraxin 1
  • PTX1MGC149895

Background

C Reactive Protein is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is a pentraxin (cyclic pentameric protein) compound of five identical nonglycosylated subunits of 206 amino acids each (m.w. 24 kDa), that are bound noncovalently to form the physiologic CRP molecule (m.w. 117.5 kDa). C Reactive Protein mediates activities associated with preimmune nonspecific host resistance. It is opsonic, an initiator of the classical complement cascade and an activator of monocytes/macrophages. CRP also binds to several nuclear components including chromatin, histones and snRNP, suggesting that it may play a role as a scavenger during cell necrosis. Studies have revealed that among other markers of inflammation, CRP shows the strongest association with cardiovascular events. Many clinical studies demonstrated that coronary mortality among patients with unstable angina and elevated CRP is significantly higher comparing with the patients without elevated CRP. Measurements of C reactive protein (hsCRP) in the patients with ischemic heart disease provide a novel method for detecting individuals at high risk of plaque rupture.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
DY417
Applications: ELISA
DLP00
Applications: ELISA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP3-16700
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MPTX20
Applications: ELISA
NBP1-87184
Species: Hu
Applications: WB, IHC

Publications for C-Reactive Protein/CRP Antibody (NBP1-87184) (0)

There are no publications for C-Reactive Protein/CRP Antibody (NBP1-87184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C-Reactive Protein/CRP Antibody (NBP1-87184) (0)

There are no reviews for C-Reactive Protein/CRP Antibody (NBP1-87184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C-Reactive Protein/CRP Antibody (NBP1-87184). (Showing 1 - 1 of 1 FAQ).

  1. We are looking to purchase some antibodies against c-reactive protein (preferably antibody clones c6 and c2). For our purpose, we are looking for antibodies that are preferably optimized for, or at least have reported use with, human serum samples, because we are wary of the serum matrix effect on the functioning of the antibody. Do you have any recommendations for these requirements?
    • For human c-reactive protein, we currently sell 18 antibodies which recognise the human protein. Of these, NB110-55637 shows a Western blot image using a human serum sample, while NBP1-87183 and NBP1-87184 have Western blot images generated using human plasma. Clone C2 has catalogue number NB100-73033 and clone C6 has catalogue number NB200-442.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C-Reactive Protein/CRP Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CRP