C-Reactive Protein/CRP Antibody


Western Blot: C-Reactive Protein Antibody [NBP1-87183] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane ...read more
Immunohistochemistry-Paraffin: C-Reactive Protein Antibody [NBP1-87183] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

C-Reactive Protein/CRP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:VRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNW
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
C-Reactive Protein/CRP Protein (NBP1-87183PEP)
Read Publication using NBP1-87183.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Alternate Names for C-Reactive Protein/CRP Antibody

  • C-reactive protein
  • C-reactive protein, pentraxin-related
  • CRP
  • MGC88244
  • pentraxin 1
  • PTX1MGC149895


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, B/N, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu
Applications: WB, Simple Western

Publications for C-Reactive Protein/CRP Antibody (NBP1-87183)(1)

Reviews for C-Reactive Protein/CRP Antibody (NBP1-87183) (0)

There are no reviews for C-Reactive Protein/CRP Antibody (NBP1-87183). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C-Reactive Protein/CRP Antibody (NBP1-87183). (Showing 1 - 1 of 1 FAQ).

  1. We are looking to purchase some antibodies against c-reactive protein (preferably antibody clones c6 and c2). For our purpose, we are looking for antibodies that are preferably optimized for, or at least have reported use with, human serum samples, because we are wary of the serum matrix effect on the functioning of the antibody. Do you have any recommendations for these requirements?
    • For human c-reactive protein, we currently sell 18 antibodies which recognise the human protein. Of these, NB110-55637 shows a Western blot image using a human serum sample, while NBP1-87183 and NBP1-87184 have Western blot images generated using human plasma. Clone C2 has catalogue number NB100-73033 and clone C6 has catalogue number NB200-442.

Secondary Antibodies


Isotype Controls

Additional C-Reactive Protein/CRP Antibody Products

Related Products by Gene

Bioinformatics Tool for C-Reactive Protein/CRP Antibody (NBP1-87183)

Discover related pathways, diseases and genes to C-Reactive Protein/CRP Antibody (NBP1-87183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C-Reactive Protein/CRP Antibody (NBP1-87183)

Discover more about diseases related to C-Reactive Protein/CRP Antibody (NBP1-87183).

Pathways for C-Reactive Protein/CRP Antibody (NBP1-87183)

View related products by pathway.

PTMs for C-Reactive Protein/CRP Antibody (NBP1-87183)

Learn more about PTMs related to C-Reactive Protein/CRP Antibody (NBP1-87183).

Research Areas for C-Reactive Protein/CRP Antibody (NBP1-87183)

Find related products by research area.

Blogs on C-Reactive Protein/CRP

There are no specific blogs for C-Reactive Protein/CRP, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol CRP

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-87183 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought