C-Reactive Protein/CRP Antibody

Images

 
Western Blot: C-Reactive Protein Antibody [NBP1-87183] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: C-Reactive Protein Antibody [NBP1-87183] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C-Reactive Protein/CRP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C-Reactive Protein/CRP Protein (NBP1-87183PEP)
Publications
Read Publication using NBP1-87183.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C-Reactive Protein/CRP Antibody

  • C-Reactive Protein
  • C-reactive protein, pentraxin-related
  • CRP
  • MGC88244
  • pentraxin 1
  • PTX1MGC149895

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
AF4409
Species: Mu
Applications: WB
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western

Publications for C-Reactive Protein/CRP Antibody (NBP1-87183)(1)

Reviews for C-Reactive Protein/CRP Antibody (NBP1-87183) (0)

There are no reviews for C-Reactive Protein/CRP Antibody (NBP1-87183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C-Reactive Protein/CRP Antibody (NBP1-87183). (Showing 1 - 1 of 1 FAQ).

  1. We are looking to purchase some antibodies against c-reactive protein (preferably antibody clones c6 and c2). For our purpose, we are looking for antibodies that are preferably optimized for, or at least have reported use with, human serum samples, because we are wary of the serum matrix effect on the functioning of the antibody. Do you have any recommendations for these requirements?
    • For human c-reactive protein, we currently sell 18 antibodies which recognise the human protein. Of these, NB110-55637 shows a Western blot image using a human serum sample, while NBP1-87183 and NBP1-87184 have Western blot images generated using human plasma. Clone C2 has catalogue number NB100-73033 and clone C6 has catalogue number NB200-442.

Secondary Antibodies

 

Isotype Controls

Additional C-Reactive Protein/CRP Products

Bioinformatics Tool for C-Reactive Protein/CRP Antibody (NBP1-87183)

Discover related pathways, diseases and genes to C-Reactive Protein/CRP Antibody (NBP1-87183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C-Reactive Protein/CRP Antibody (NBP1-87183)

Discover more about diseases related to C-Reactive Protein/CRP Antibody (NBP1-87183).
 

Pathways for C-Reactive Protein/CRP Antibody (NBP1-87183)

View related products by pathway.

PTMs for C-Reactive Protein/CRP Antibody (NBP1-87183)

Learn more about PTMs related to C-Reactive Protein/CRP Antibody (NBP1-87183).
 

Research Areas for C-Reactive Protein/CRP Antibody (NBP1-87183)

Find related products by research area.

Blogs on C-Reactive Protein/CRP

There are no specific blogs for C-Reactive Protein/CRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C-Reactive Protein/CRP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRP
Entrez