c-Myc Antibody

Images

 
Western Blot: c-Myc Antibody [NBP2-49201] - Western Blot of c-MYC antibody against purple sea urchin 4.5hr embryo lysate. Band appeared near the expected size of 48 kDa. WB image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: c-Myc Antibody [NBP2-49201] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: c-Myc Antibody [NBP2-49201] - Staining of human cerebellum shows moderate to strong positivity in nucleoli in purkinje cells.
Immunohistochemistry-Paraffin: c-Myc Antibody [NBP2-49201] - Staining of human skeletal muscle shows weak to moderate positivity in myocytes.
Immunohistochemistry-Paraffin: c-Myc Antibody [NBP2-49201] - Staining of human kidney shows moderate to strong positivity in nucleoli in cells in tubules.
Immunohistochemistry-Paraffin: c-Myc Antibody [NBP2-49201] - Staining of human testis shows moderate to strong positivity in nucleoli in cells in seminiferous ducts.

Product Details

Summary
Product Discontinued
View other related c-Myc Primary Antibodies

Order Details


    • Catalog Number
      NBP2-49201
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

c-Myc Antibody Summary

Immunogen
This antibody was developed against a c-Myc Antibody recombinant protein corresponding to amino acids: SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSE
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. c-Myc antibody validated for WB from a verified customer review.
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP2-49201 in the following applications:

Publications
Read Publications using NBP2-49201.

Reactivity Notes

Rat (89%). S. purpuratus (Sea urchin) reactivity reported from a a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for c-Myc Antibody

  • avian myelocytomatosis viral oncogene homolog
  • BHLHE39
  • bHLHe39MRTL
  • Class E basic helix-loop-helix protein 39
  • cMyc
  • c-Myc
  • myc proto-oncogene protein
  • Myc
  • Myc2
  • MYCC
  • myc-related translation/localization regulatory factor
  • Niard
  • Nird
  • Proto-oncogene c-Myc
  • Transcription factor p64
  • v-myc avian myelocytomatosis viral oncogene homolog
  • v-myc myelocytomatosis viral oncogene homolog (avian)

Background

The c-Myc protein is a transcription factor, which is encoded by the c-Myc gene on human chromosome 8q24. c-Myc is a multifunctional, nuclear phosphoprotein that functions as a transcription factor with a theoretical molecular weight of 62kDa. However, c-Myc is extremely labile and is degraded very quickly even in extracts prepared with boiling SDS sample buffer, such that a molecular weight of ~40 kDa has been observed. c-Myc is part of a heterodimeric complex with Max that acts as a potent transcriptional activator. c-Myc is modified by glycosylation and phosphorylation and has been shown to interact with numerous proteins including SMAD2, SMAD3, LSD1/KDM1A, MAD, and Sp1 (1).

A basic Helix-Loop-Helix, Leucine Zipper domain (bHLH/LZ), designated Max, specifically associates with c-Myc, N-Myc and L-Myc proteins. The Myc-Max complex binds to DNA in a sequence-specific manner under conditions where neither Max nor Myc exhibit appreciable binding. Max can also form heterodimers with other bHLH-Zip proteins, Mad and Mxi1. c-Myc plays a role in cell cycle progression, apoptosis, cellular transformation and angiogenesis (2). Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of cancers including B-cell Lymphomas, acute myeloid leukemia, glioblastoma, stomach adenocarcinoma, and prostate adenocarcinoma (3).

References

1. Wilkinson, D. S., Tsai, W. W., Schumacher, M. A., & Barton, M. C. (2008). Chromatin-bound p53 anchors activated Smads and the mSin3A corepressor to confer transforming-growth-factor-beta-mediated transcription repression. Mol Cell Biol, 28(6), 1988-1998. doi:10.1128/mcb.01442-07

2. Pedrosa, A. R., Bodrug, N., Gomez-Escudero, J., Carter, E. P., Reynolds, L. E., Georgiou, P. N., . . . Hodivala-Dilke, K. M. (2019). Tumor Angiogenesis Is Differentially Regulated by Phosphorylation of Endothelial Cell Focal Adhesion Kinase Tyrosines-397 and -861. Cancer Res, 79(17), 4371-4386. doi:10.1158/0008-5472.Can-18-3934

3. Nagasaka, M., Tsuzuki, K., Ozeki, Y., Tokugawa, M., Ohoka, N., Inoue, Y., & Hayashi, H. (2019). Lysine-Specific Demethylase 1 (LSD1/KDM1A) Is a Novel Target Gene of c-Myc. Biol Pharm Bull, 42(3), 481-488. doi:10.1248/bpb.b18-00892

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-793
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
236-EG
Species: Hu
Applications: BA
1129-ER
Species: Hu
Applications: BA
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-49201
Species: Hu, Mu
Applications: WB, ICC/IF, IHC

Publications for c-Myc Antibody (NBP2-49201)(2)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Review for c-Myc Antibody (NBP2-49201) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: S. purpuratus.

Reviews using NBP2-49201:
Filter by Applications
WB
(1)
All Applications
Filter by Species
S. purpuratus
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot c-Myc NBP2-49201
Enlarge
4
reviewed by:
Verified Customer
WB S. purpuratus 09/02/2021
View

Summary

ApplicationWestern Blot
Sample Tested4.5hr sea urchin embryo lysate,4.5hr Sea Urchin Embryo
SpeciesS. purpuratus
LotA117479

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for c-Myc Antibody (NBP2-49201) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional c-Myc Products

Research Areas for c-Myc Antibody (NBP2-49201)

Find related products by research area.

Blogs on c-Myc. Showing 1-10 of 15 blog posts - Show all blog posts.

Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.

The role of c-Fos in the regulation of the JC virus gene transcription
c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B.  Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D.  Each member of the AP-1 transcri...  Read full blog post.

Dual applications of a c-Myc antibody in mitochondrial research
c-Myc, a proto-oncogene, has documented involvement in cellular differentiation, cell growth, cell death and tumor formation.  Target genes of the Myc family include those that participate in cell survival, translation, transcription, metabolism and...  Read full blog post.

MAPK8/JNK1 - A multifunctional kinase and drug target for cancer therapeutics
The c-Jun N-terminal kinase (JNK) family is a group of regulatory kinases with important functions in cell morphogenesis, inflammation, differentiation, and cell death (1). Aberrant activation of JNK family proteins in cancers has led to interest i...  Read full blog post.

MYC - A human oncogene with valuable laboratory applications
Myc is a basic helix-loop-helix zipper transcription factor that regulates a network of many hundreds of genes. Myc up-regulates the expression of many genes involved in cell growth and proliferation such as ribosome biogenesis and protein synthesi...  Read full blog post.

c-Myc - transcription factor and oncogene
c-Myc is a protein of the Myc family of transcription factors (c-Myc, B-Myc, L-Myc, N-Myc, and s-Myc) encoded by the MYC proto-oncogene. c-Myc was first discovered as the cellular homolog of the retroviral v-Myc oncogene. c-Myc is a transcription ...  Read full blog post.

c-Myc. See Myc Run Transcription Regulation
Myc genes (L-Myc, N-Myc and C-Myc) are a family of transcription factors. c-Myc is involved in transcription regulation, apoptosis and cell growth. Mutations in c-Myc have been tied to several cancers. Free sample bonus: Get a free sample on ...  Read full blog post.

Beta Catenin Implications for Signaling
The Wnt/beta Catenin signaling pathway plays a critical role in embryonic development, stem cell self-renewal and regeneration. Alterations in this signaling cascade have been implicated in the pathogenesis of cancer. Notably, chronic activation of Wn...  Read full blog post.

Cerebellar Degeneration-Related Protein 2 (CDR2): Cell-Cycle Regulated Tumor Antigen
CDR2 is a tumor antigen expressed in a high percentage of breast and ovarian tumors and is the target of a naturally occurring tumor immune response in patients with paraneoplastic cerebellar degeneration. CDR2 has also been shown to be a cell cycle r...  Read full blog post.

CIP2A: The Cancerous Inhibitor of Protein Phosphatase 2A
The autoantigen p90 is a recently discovered protein that binds to and inhibits Protein Phosphatase 2A (PP2A) activity, thereby playing a critical role in cancer progression. Thus, p90 was renamed the "cancerous inhibitory protein of PP2A" or CIP2A....  Read full blog post.

Showing 1-10 of 15 blog posts - Show all blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
09/02/2021
Application: WB
Species: S. purpuratus

Bioinformatics

Gene Symbol MYC