Immunogen | This antibody was developed against a c-Myc Antibody recombinant protein corresponding to amino acids: SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSE |
Predicted Species | Mouse (92%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | MYC |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. c-Myc antibody validated for WB from a verified customer review. |
|
Theoretical MW | 67 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Verified Customer |
WB | S. purpuratus | 09/02/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for c-Myc Antibody (NBP2-49201)Find related products by research area.
|
Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu... Read full blog post. |
The role of c-Fos in the regulation of the JC virus gene transcription c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B. Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D. Each member of the AP-1 transcri... Read full blog post. |
Dual applications of a c-Myc antibody in mitochondrial research c-Myc, a proto-oncogene, has documented involvement in cellular differentiation, cell growth, cell death and tumor formation. Target genes of the Myc family include those that participate in cell survival, translation, transcription, metabolism and... Read full blog post. |
MAPK8/JNK1 - A multifunctional kinase and drug target for cancer therapeutics The c-Jun N-terminal kinase (JNK) family is a group of regulatory kinases with important functions in cell morphogenesis, inflammation, differentiation, and cell death (1). Aberrant activation of JNK family proteins in cancers has led to interest i... Read full blog post. |
MYC - A human oncogene with valuable laboratory applications Myc is a basic helix-loop-helix zipper transcription factor that regulates a network of many hundreds of genes. Myc up-regulates the expression of many genes involved in cell growth and proliferation such as ribosome biogenesis and protein synthesi... Read full blog post. |
c-Myc - transcription factor and oncogene c-Myc is a protein of the Myc family of transcription factors (c-Myc, B-Myc, L-Myc, N-Myc, and s-Myc) encoded by the MYC proto-oncogene. c-Myc was first discovered as the cellular homolog of the retroviral v-Myc oncogene. c-Myc is a transcription ... Read full blog post. |
c-Myc. See Myc Run Transcription Regulation Myc genes (L-Myc, N-Myc and C-Myc) are a family of transcription factors. c-Myc is involved in transcription regulation, apoptosis and cell growth. Mutations in c-Myc have been tied to several cancers. Free sample bonus: Get a free sample on ... Read full blog post. |
Beta Catenin Implications for Signaling The Wnt/beta Catenin signaling pathway plays a critical role in embryonic development, stem cell self-renewal and regeneration. Alterations in this signaling cascade have been implicated in the pathogenesis of cancer. Notably, chronic activation of Wn... Read full blog post. |
Cerebellar Degeneration-Related Protein 2 (CDR2): Cell-Cycle Regulated Tumor Antigen CDR2 is a tumor antigen expressed in a high percentage of breast and ovarian tumors and is the target of a naturally occurring tumor immune response in patients with paraneoplastic cerebellar degeneration. CDR2 has also been shown to be a cell cycle r... Read full blog post. |
CIP2A: The Cancerous Inhibitor of Protein Phosphatase 2A The autoantigen p90 is a recently discovered protein that binds to and inhibits Protein Phosphatase 2A (PP2A) activity, thereby playing a critical role in cancer progression. Thus, p90 was renamed the "cancerous inhibitory protein of PP2A" or CIP2A.... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | MYC |