BPIL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BPIL1 Antibody [NBP2-14358] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human kidney.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human salivary gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining in human salivary gland and liver tissues using anti-BPIFB2 antibody. Corresponding BPIFB2 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human colon, kidney, liver and salivary gland using Anti-BPIFB2 antibody NBP2-14358 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BPIL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLE VNAVLFLLGKPIILPTDAT
Specificity
Specificity of human BPIL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BPIFB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BPIL1 Protein (NBP2-14358PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BPIL1 Antibody

  • bactericidal/permeability-increasing protein-like 1
  • C20orf184
  • Long palate, lung and nasal epithelium carcinoma-associated protein 2
  • LPLUNC2dJ726C3.2
  • RYSR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1897
Species: Hu
Applications: WB, ELISA
NBP1-88372
Species: Hu
Applications: WB, IHC, IHC-P
LBP
6445-LP/CF
Species: Hu
NBP1-84915
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38507
Species: Hu
Applications: IHC, IHC-P
NBP2-38507
Species: Hu
Applications: IHC, IHC-P
NBP2-37489
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-98689
Species: Hu, Mu
Applications: WB, DB, ICC/IF, IHC, IHC-Fr, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB120-10109
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
NBP3-00103
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-90127
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-03483
Species: Hu, Rt, Ca, Pm, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-06979
Species: Hu
Applications: WB, PEP-ELISA
NBP1-26549
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for BPIL1 Antibody (NBP2-14358) (0)

There are no publications for BPIL1 Antibody (NBP2-14358).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPIL1 Antibody (NBP2-14358) (0)

There are no reviews for BPIL1 Antibody (NBP2-14358). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BPIL1 Antibody (NBP2-14358) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BPIL1 Products

Bioinformatics Tool for BPIL1 Antibody (NBP2-14358)

Discover related pathways, diseases and genes to BPIL1 Antibody (NBP2-14358). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPIL1 Antibody (NBP2-14358)

Discover more about diseases related to BPIL1 Antibody (NBP2-14358).

Blogs on BPIL1

There are no specific blogs for BPIL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BPIL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BPIFB2