BPIL1 Antibody

Immunocytochemistry/Immunofluorescence: BPIL1 Antibody [NBP2-14358] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles.

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human kidney.

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human salivary gland shows high expression.

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining in human salivary gland and liver tissues using anti-BPIFB2 antibody. Corresponding BPIFB2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human colon, kidney, liver and salivary gland using Anti-BPIFB2 antibody NBP2-14358 (A) shows similar protein distribution across tissues to independent antibody NBP2-38887 (B).

Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-14358] - Staining of human colon.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

BPIL1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BPIFB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BPIL1 Protein (NBP2-14358PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BPIL1 Antibody

• bactericidal/permeability-increasing protein-like 1
• C20orf184
• Long palate, lung and nasal epithelium carcinoma-associated protein 2
• LPLUNC2dJ726C3.2
• RYSR

Background

The BPIL1 gene encodes a member of the lipid transfer/lipopolysaccharide binding protein (LT/LBP) gene family. It is highly expressed in hypertrophic tonsils. This gene and three other members of the LT/LBP gene family form a cluster on the long arm of chromos

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BPIFB2