BPIL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BPIL2 Antibody [NBP1-90753] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: BPIL2 Antibody [NBP1-90753] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BPIL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NVLSRIAEIYILSQPFMVRIMATEPPIINLQPGNFTLDIPASIMMLTQPKNSTVETIVSMDFVASTSVGLVILGQRLVCSLSLNRFR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BPIFC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BPIL2 Protein (NBP1-90753PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BPIL2 Antibody

  • bactericidal/permeability-increasing protein-like 2
  • BPI fold containing family C
  • BPI fold-containing family C protein
  • BPI-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14358
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7636
Species: Hu
Applications: IHC
870-LP/CF
Species: Hu
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-88372
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
BPI
7468-BP
Species: Hu
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BPIL2 Antibody (NBP1-90753) (0)

There are no publications for BPIL2 Antibody (NBP1-90753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPIL2 Antibody (NBP1-90753) (0)

There are no reviews for BPIL2 Antibody (NBP1-90753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BPIL2 Antibody (NBP1-90753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BPIL2 Products

Bioinformatics Tool for BPIL2 Antibody (NBP1-90753)

Discover related pathways, diseases and genes to BPIL2 Antibody (NBP1-90753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPIL2 Antibody (NBP1-90753)

Discover more about diseases related to BPIL2 Antibody (NBP1-90753).

Blogs on BPIL2

There are no specific blogs for BPIL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BPIL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BPIFC