Apolipoprotein L2 Antibody

Western Blot: Apolipoprotein L2 Antibody [NBP1-90127] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-APOL2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: Apolipoprotein L2 Antibody [NBP1-90127] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Apolipoprotein L2 Antibody [NBP1-90127] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Western Blot: Apolipoprotein L2 Antibody [NBP1-90127] - Analysis in human cell line HDLM-2.

Immunohistochemistry-Paraffin: Apolipoprotein L2 Antibody [NBP1-90127] - Staining of human hippocampus shows strong cytoplasmic and weak nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: Apolipoprotein L2 Antibody [NBP1-90127] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding APOL2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Apolipoprotein L2 Antibody [NBP1-90127] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: Apolipoprotein L2 Antibody [NBP1-90127] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Apolipoprotein L2 Antibody [NBP1-90127] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Apolipoprotein L2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LGVRVREEEAGTRVKENLPVWTVTGELQGKPLGNPAAGTMNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Apolipoprotein L2 Protein (NBP1-90127PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24901046).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Apolipoprotein L2 Antibody

• APOL3
• APOL-II
• apolipoprotein L, 2
• apolipoprotein L2
• Apolipoprotein L-II

Background

Apolipoprotein L2 is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Apolipoprotein L2 Antibody (NBP1-90127)(1)

Publication using NBP1-90127

• Galindo-Moreno J, Iurlaro R, El Mjiyad N et al. Apolipoprotein L2 contains a BH3-like domain but it does not behave as a BH3-only protein. Cell Death Dis 2014-06-05 [PMID: 24901046] (WB, Human)

Bioinformatics

• Gene Symbol: APOL2
• Entrez:
  • 23780(Human)
• Uniprot:
  • Q9BQE5(Human)