EHHADH Antibody

Images

 
Western Blot: EHHADH Antibody [NBP1-84915] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: EHHADH Antibody [NBP1-84915] - Staining of human cell line U-2 OS shows positivity in cytoplasm and vesicles.
Immunohistochemistry-Paraffin: EHHADH Antibody [NBP1-84915] - Staining of human liver shows strong cytoplasmic positivity, with a granular pattern in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EHHADH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EHHADH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EHHADH Protein (NBP1-84915PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EHHADH Antibody

  • enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
  • enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase
  • LBFP
  • LBP
  • L-PBE
  • PBFEMGC120586
  • peroxisomal bifunctional enzyme3,2-trans-enoyl-CoA isomerase
  • peroxisomal enoyl-CoA hydratase
  • peroxisomal

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
BPI
7468-BP
Species: Hu
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF5739
Species: Hu, Mu, Rt
Applications: WB
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for EHHADH Antibody (NBP1-84915) (0)

There are no publications for EHHADH Antibody (NBP1-84915).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EHHADH Antibody (NBP1-84915) (0)

There are no reviews for EHHADH Antibody (NBP1-84915). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EHHADH Antibody (NBP1-84915) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EHHADH Products

Bioinformatics Tool for EHHADH Antibody (NBP1-84915)

Discover related pathways, diseases and genes to EHHADH Antibody (NBP1-84915). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EHHADH Antibody (NBP1-84915)

Discover more about diseases related to EHHADH Antibody (NBP1-84915).
 

Pathways for EHHADH Antibody (NBP1-84915)

View related products by pathway.

PTMs for EHHADH Antibody (NBP1-84915)

Learn more about PTMs related to EHHADH Antibody (NBP1-84915).

Blogs on EHHADH

There are no specific blogs for EHHADH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EHHADH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EHHADH