beta-Catenin Antibody (6A3P2)

Western Blot: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Western blot analysis of extracts of Mouse brain, using beta-Catenin antibody (NBP3-15842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Western blot analysis of extracts of HeLa cells, using beta-Catenin antibody (NBP3-15842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Western blot analysis of extracts from normal (control) and beta-Catenin knockout (KO) 293T cells, using beta-Catenin antibody (NBP3-15842) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunoprecipitation: beta-Catenin Antibody (9L6X0) [NBP3-15842] - Immunoprecipitation analysis of 600ug extracts of Mouse brain using 3ug beta-Catenin antibody (NBP3-15842). Western blot was performed from the immunoprecipitate using beta-Catenin (NBP3-15842) at a dilition of 1:1000.

Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Confocal imaging of paraffin-embedded Human colon tissue using [KO Validated] beta-Catenin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Immunohistochemistry: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Immunohistochemistry analysis of paraffin-embedded Human liver using [KO Validated] beta-Catenin Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using [KO Validated] beta-Catenin Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Western blot analysis of lysates from NIH/3T3 cells, using [KO Validated] beta-Catenin Rabbit mAb at 1:1000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Western Blot: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Western blot analysis of lysates from wild type(WT) and beta-Catenin knockout (KO) 293T(KO) cells, using [KO Validated] beta-Catenin Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunohistochemistry: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Immunohistochemistry analysis of paraffin-embedded Human kidney using [KO Validated] beta-Catenin Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Confocal imaging of paraffin-embedded Mouse colon tissue using [KO Validated] beta-Catenin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Immunohistochemistry: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Immunohistochemistry analysis of paraffin-embedded Human solitary fibrous tumor tissue using [KO Validated] beta-Catenin Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Confocal imaging of paraffin-embedded Human prostate cancer tissue using [KO Validated] beta-Catenin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Immunohistochemistry: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using [KO Validated] beta-Catenin Rabbit mAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: beta-Catenin Antibody (6A3P2) [beta-Catenin] - Confocal imaging of paraffin-embedded Rat colon tissue using [KO Validated] beta-Catenin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP, KO
• Clone: 6A3P2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

beta-Catenin Antibody (6A3P2) Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit beta-Catenin Antibody (6A3P2) (NBP3-15842) is a recombinant monoclonal antibody validated for use in IHC, WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (P35222). MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CTNNB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Knockout Validated
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 92 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for beta-Catenin Antibody (6A3P2)

• bCatenin
• beta 1 (88kD)
• beta-Catenin
• catenin (cadherin-associated protein), beta 1, 88kDa
• catenin beta-1
• CTNNB
• CTNNB1
• DKFZp686D02253
• FLJ25606
• FLJ37923

Background

The protein encoded by the beta Catenin gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs arenecessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion betweencells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contactinhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this proteinbinds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this geneare a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Three transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTNNB1