LEF1 Antibody

Images

 
Western Blot: LEF1 Antibody [NBP1-86960] - Analysis in human cell line MOLT-4.
Immunocytochemistry/ Immunofluorescence: LEF1 Antibody [NBP1-86960] - Staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human pancreas shows no nuclear positivity as expected.
Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human lymph node shows moderate to strong nuclear positivity in non - germinal center cells.
Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human tonsil shows moderate nuclear positivity in non - germinal center cells.
Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human oral mucosa shows moderate nuclear positivity in subset of squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LEF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LEF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LEF1 Protein (NBP1-86960PEP)
Publications
Read Publication using NBP1-86960.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LEF1 Antibody

  • DKFZp586H0919
  • FLJ46390
  • LEF1
  • LEF-1
  • lymphoid enhancer-binding factor 1
  • T cell-specific transcription factor 1-alpha
  • TCF10
  • TCF1ALPHA
  • TCF1-alpha
  • TCF7L3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF5596
Species: Hu
Applications: WB, IHC, ICC
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF1620
Species: Mu
Applications: WB, IHC
AF3287
Species: Hu, Mu, Rt
Applications: WB
AF4885
Species: Mu
Applications: WB, IP
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-86960
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LEF1 Antibody (NBP1-86960)(1)

Reviews for LEF1 Antibody (NBP1-86960) (0)

There are no reviews for LEF1 Antibody (NBP1-86960). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LEF1 Antibody (NBP1-86960) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LEF1 Products

Bioinformatics Tool for LEF1 Antibody (NBP1-86960)

Discover related pathways, diseases and genes to LEF1 Antibody (NBP1-86960). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEF1 Antibody (NBP1-86960)

Discover more about diseases related to LEF1 Antibody (NBP1-86960).
 

Pathways for LEF1 Antibody (NBP1-86960)

View related products by pathway.

PTMs for LEF1 Antibody (NBP1-86960)

Learn more about PTMs related to LEF1 Antibody (NBP1-86960).
 

Research Areas for LEF1 Antibody (NBP1-86960)

Find related products by research area.

Blogs on LEF1.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LEF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LEF1
Entrez