TCF7L2 Antibody (3A4)

Images

 
Western Blot: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of TCF7L2 expression in K-562 (Cat # L009V1).
Immunocytochemistry/ Immunofluorescence: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
ELISA: TCF7L2 Antibody (3A4) [H00006934-M06] - Detection limit for recombinant GST tagged TCF7L2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
3A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCF7L2 Antibody (3A4) Summary

Immunogen
TCF7L2 (NP_110383 490 a.a. - 596 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE
Specificity
TCF7L2 (3A4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TCF7L2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00006934-M06 in the following applications:

Publications
Read Publication using
H00006934-M06 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCF7L2 Antibody (3A4)

  • HMG box transcription factor 4
  • hTCF-4
  • T-cell factor 4
  • T-cell factor-4 variant A
  • T-cell factor-4 variant B
  • T-cell factor-4 variant C
  • T-cell factor-4 variant D
  • T-cell factor-4 variant E
  • T-cell factor-4 variant H
  • T-cell factor-4 variant I
  • T-cell factor-4 variant J
  • T-cell factor-4 variant K
  • T-cell factor-4 variant L
  • T-cell factor-4 variant M
  • T-cell factor-4 variant X2
  • T-cell-specific transcription factor 4
  • TCF-4T-cell factor-4 variant F
  • TCF4T-cell factor-4 variant G
  • transcription factor 7-like 2 (T-cell specific, HMG-box)
  • transcription factor 7-like 2

Background

The TCL7L2 gene product is a high mobility group (HMG) box-containing transcription factor implicated in blood glucose homeostasis. The study of Yi et al. (2005) [PubMed 15525634] suggested that TCL7L2 acts through regulation of proglucagon (MIM 138030) through repression of the proglucagon gene in enteroendocrine cells via the Wnt signaling pathway.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF6116
Species: Hu
Applications: WB, ICC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF4885
Species: Mu
Applications: WB, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB7650
Species: Mu
Applications: WB, IHC
AF5596
Species: Hu
Applications: WB, IHC, ICC
AF7318
Species: Hu
Applications: IHC
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for TCF7L2 Antibody (H00006934-M06)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for TCF7L2 Antibody (H00006934-M06) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00006934-M06:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TCF7L2 H00006934-M06
Enlarge
reviewed by:
Sarah Daud
WB Human 08/22/2012
View

Summary

ApplicationWestern Blot
Sample TestedK562 nuclear lysate
SpeciesHuman
Lot08312-3A4
CommentsThe epitope sequence of this antibody detects the common region within exon 18 of TCF7L2 gene which gives a strong band at 58 kDa and 72 kDa for myeloid cell lines. This antibody is very sensitive and also able to pick up other protein isoforms of TCF7L2 due to splice variants mostly seen at lower molecular weight. Although the recommended dilution is 1:500 however 1:5000 already giving very bright signal detected either by ECL Prime or ECL Advance chemiluminescent substrates. This antibody is very good at giving quantitative response compared to other TCF7L2 antibodies i have tested from other companies. Although in general,other brands are very sensitive but mostly are not as quantitative as Novus Bio. I was able to measure expression signals levels between samples as low as 2 fold differences. Highly recommended.

Blocking

Blocking DetailsAmersham ECL Advance Blocking Reagent:GE Healthcare,5% block in TBS-Tween20, for 30 min, Room Temperature.

Primary Anitbody

Dilution Ratiodilution for primary Ab was 1:5000, using 5% blocking agent in 0.1% Tween 20 in Tris-buffered saline,for 16 hours at 4 degrees.

Secondary Antibody

Secondary Descriptionanti-mouse IgG - HRP
Secondary Manufacturer Cat#Amersham cat# NA931V
Secondary Concentration1 in 50 dilution

Details

Detection NotesAmersham ECL Prime Western Blotting Detection kit GE Healthcare, captured using LAS3000-Imager for 10 minutes,+ve control Jurkat

Comments

CommentsThe epitope sequence of this antibody detects the common region within exon 18 of TCF7L2 gene which gives a strong band at 58 kDa and 72 kDa for myeloid cell lines. This antibody is very sensitive and also able to pick up other protein isoforms of TCF7L2 due to splice variants mostly seen at lower molecular weight. Although the recommended dilution is 1:500 however 1:5000 already giving very bright signal detected either by ECL Prime or ECL Advance chemiluminescent substrates. This antibody is very good at giving quantitative response compared to other TCF7L2 antibodies i have tested from other companies. Although in general,other brands are very sensitive but mostly are not as quantitative as Novus Bio. I was able to measure expression signals levels between samples as low as 2 fold differences. Highly recommended.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCF7L2 Antibody (H00006934-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF7L2 Products

Bioinformatics Tool for TCF7L2 Antibody (H00006934-M06)

Discover related pathways, diseases and genes to TCF7L2 Antibody (H00006934-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF7L2 Antibody (H00006934-M06)

Discover more about diseases related to TCF7L2 Antibody (H00006934-M06).
 

Pathways for TCF7L2 Antibody (H00006934-M06)

View related products by pathway.

PTMs for TCF7L2 Antibody (H00006934-M06)

Learn more about PTMs related to TCF7L2 Antibody (H00006934-M06).
 

Research Areas for TCF7L2 Antibody (H00006934-M06)

Find related products by research area.

Blogs on TCF7L2

There are no specific blogs for TCF7L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Sarah Daud
08/22/2012
Application: WB
Species: Human

Bioinformatics

Gene Symbol TCF7L2
Entrez
OMIM
Uniprot