BDNF Recombinant Protein Antigen

Images

 
There are currently no images for BDNF Recombinant Protein Antigen (NBP2-55052PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BDNF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BDNF.

Source: E. coli

Amino Acid Sequence: PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BDNF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55052.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BDNF Recombinant Protein Antigen

  • Abrineurin
  • ANON2
  • BDNF
  • brain-derived neurotrophic factor
  • BULN2
  • MGC34632
  • Neurotrophin

Background

FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family. BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

267-N3
Species: Hu
Applications: BA
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
256-GF
Species: Hu
Applications: BA
AF1056
Species: Rt
Applications: IHC, WB
268-N4
Species: Hu
Applications: BA
AF1157
Species: Mu
Applications: IHC, WB
212-GD
Species: Hu
Applications: Bind, BA
H00007170-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
257-NT
Species: Hu
Applications: BA
MAB3468
Species: Hu
Applications: ICC, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DRT200
Species: Hu
Applications: ELISA
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
233-FB
Species: Hu
Applications: BA

Publications for BDNF Recombinant Protein Antigen (NBP2-55052PEP) (0)

There are no publications for BDNF Recombinant Protein Antigen (NBP2-55052PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BDNF Recombinant Protein Antigen (NBP2-55052PEP) (0)

There are no reviews for BDNF Recombinant Protein Antigen (NBP2-55052PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BDNF Recombinant Protein Antigen (NBP2-55052PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BDNF Products

Research Areas for BDNF Recombinant Protein Antigen (NBP2-55052PEP)

Find related products by research area.

Blogs on BDNF. Showing 1-10 of 11 blog posts - Show all blog posts.


  Read full blog post.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ...  Read full blog post.

TrkB and Nervous System Function
Neutrophins and their receptors play an important role in regulating the development of both the central and peripheral nervous systems. Neurotrophin ligand binding to each of their respective Trk cellular receptors is essential for the growth and sur...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

BDNF Antibodies Aid Research on Alzheimer's Therapies
Brain-derived neurotrophic factor (BDNF) is known to be important for neuronal differentiation, survival, migration and plasticity in both the developing embryo and adult synapses. The BDNF antibody is also proving to be an important tool in Alzheimer...  Read full blog post.

BDNF Antibodies and Synaptic Research
Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophins. During development it regulates the survival and differentiation of neuronal cell populations in the central and peripheral nervous system, while in adult synapse...  Read full blog post.

Showing 1-10 of 11 blog posts - Show all blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BDNF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BDNF