BDNF Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BDNF Antibody [NBP2-58796] - Staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria.

Product Details

Summary
Product Discontinued
View other related BDNF Primary Antibodies

Order Details


    • Catalog Number
      NBP2-58796
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BDNF Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSK
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BDNF
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for BDNF Antibody

  • Abrineurin
  • ANON2
  • BDNF
  • brain-derived neurotrophic factor
  • BULN2
  • MGC34632
  • Neurotrophin

Background

FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family. BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

267-N3
Species: Hu
Applications: BA
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
256-GF
Species: Hu
Applications: BA
AF1056
Species: Rt
Applications: IHC, WB
268-N4
Species: Hu
Applications: BA
AF1157
Species: Mu
Applications: IHC, WB
212-GD
Species: Hu
Applications: Bind, BA
H00007170-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF1404
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
257-NT
Species: Hu
Applications: BA
MAB3468
Species: Hu
Applications: ICC, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DRT200
Species: Hu
Applications: ELISA
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
233-FB
Species: Hu
Applications: BA

Publications for BDNF Antibody (NBP2-58796) (0)

There are no publications for BDNF Antibody (NBP2-58796).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BDNF Antibody (NBP2-58796) (0)

There are no reviews for BDNF Antibody (NBP2-58796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BDNF Antibody (NBP2-58796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BDNF Products

Research Areas for BDNF Antibody (NBP2-58796)

Find related products by research area.

Blogs on BDNF. Showing 1-10 of 11 blog posts - Show all blog posts.


  Read full blog post.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

TrkB: Bridging Ontogenesis and Oncogenesis
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ...  Read full blog post.

TrkB and Nervous System Function
Neutrophins and their receptors play an important role in regulating the development of both the central and peripheral nervous systems. Neurotrophin ligand binding to each of their respective Trk cellular receptors is essential for the growth and sur...  Read full blog post.

TrkB: Docking for Neurotrophins and Beyond.
Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro...  Read full blog post.

BDNF Antibodies Aid Research on Alzheimer's Therapies
Brain-derived neurotrophic factor (BDNF) is known to be important for neuronal differentiation, survival, migration and plasticity in both the developing embryo and adult synapses. The BDNF antibody is also proving to be an important tool in Alzheimer...  Read full blog post.

BDNF Antibodies and Synaptic Research
Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophins. During development it regulates the survival and differentiation of neuronal cell populations in the central and peripheral nervous system, while in adult synapse...  Read full blog post.

Showing 1-10 of 11 blog posts - Show all blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BDNF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BDNF