BCR Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BCR Antibody [NBP1-89137] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: BCR Antibody [NBP1-89137] - Staining of human thyroid gland shows strong cytoplasmic and extra cellular positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BCR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BCR Antibody - BSA Free (NBP1-89137) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRW
• Predicted Species: Mouse (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BCR Protein (NBP1-89137PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BCR Antibody - BSA Free

• ALL
• ALLD22S11
• BCR
• BCR1
• breakpoint cluster region protein
• breakpoint cluster region
• CMLEC 2.7.11.1
• D22S662
• PHL
• PHLFLJ16453
• Renal carcinoma antigen NY-REN-26

Background

The breakpoint cluster region protein (Bcr) is best know to be involved in genomic translocation with fusion partner Abl (Cbr-Abl) causing chronic myelogenous leukemia (CML) (1-2). This 160 kDa protein contains a serine/threonine kinase domain, an SH2 binding domain, a GTP/GDP exchange domain and a C-term domain which functions as a GTPase activating protein for p21rac and CDC42 (3). Additionally, Bcr is involved in signal transduction and can down regulate Ras mediated cell signaling (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCR