BCR Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BCR Antibody [NBP1-89137] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: BCR Antibody [NBP1-89137] - Staining of human thyroid gland shows strong cytoplasmic and extra cellular positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BCR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BCR Protein (NBP1-89137PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCR Antibody

  • ALL
  • ALLD22S11
  • BCR
  • BCR1
  • breakpoint cluster region protein
  • breakpoint cluster region
  • CMLEC 2.7.11.1
  • D22S662
  • PHL
  • PHLFLJ16453
  • Renal carcinoma antigen NY-REN-26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-49154
Species: Hu
Applications: IHC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for BCR Antibody (NBP1-89137) (0)

There are no publications for BCR Antibody (NBP1-89137).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCR Antibody (NBP1-89137) (0)

There are no reviews for BCR Antibody (NBP1-89137). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BCR Antibody (NBP1-89137) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCR Products

Bioinformatics Tool for BCR Antibody (NBP1-89137)

Discover related pathways, diseases and genes to BCR Antibody (NBP1-89137). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCR Antibody (NBP1-89137)

Discover more about diseases related to BCR Antibody (NBP1-89137).
 

Pathways for BCR Antibody (NBP1-89137)

View related products by pathway.

PTMs for BCR Antibody (NBP1-89137)

Learn more about PTMs related to BCR Antibody (NBP1-89137).
 

Research Areas for BCR Antibody (NBP1-89137)

Find related products by research area.

Blogs on BCR

There are no specific blogs for BCR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCR
Entrez