LIS1 Antibody - BSA Free

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Analysis in human testis and liver tissues using NBP1-87769 antibody. Corresponding PAFAH1B1 RNA-seq data are presented for the same tissues.

Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image submitted by a verified customer review.

Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining LIS1 in Caco-2 cells using anti-LIS1 antibody. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human cerebellum shows moderate positivity in neuropil.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LIS1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAFAH1B1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. LIS1 antibody validated for ICC/IF, WB from verified customer reviews.
• Control Peptide:

  LIS1 Protein (NBP1-87769PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LIS1 Antibody - BSA Free

• LIS-1
• LIS1PAF-AH alpha
• LIS2
• lissencephaly 1 protein
• Lissencephaly-1 protein
• MDCR
• MDS
• Miller-Dieker syndrome chromosome region
• PAF acetylhydrolase 45 kDa subunit
• PAF-AH 45 kDa subunit
• PAFAH alpha
• PAFAH
• PAFAHA
• platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
• platelet-activating factor acetylhydrolase IB subunit alpha
• platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD)
• platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa
• platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)

Background

Lissencephaly (LIS), literally meaning smooth brain, has multiple causes. Agyria, i.e., brain without convolutions or gyri, was considered a rare malformation until recent progress in neuroradiology. With this technical advantage, a number of lissencephaly syndromes have been distinguished. Classic lissencephaly (type I) is a brain malformation caused by abnormal neuronal migration at 9 to 13 weeks' gestation, resulting in a spectrum of agyria, mixed agyria / pachygyria, and pachygyria. It is characterized by an abnormally thick and poorly organized cortex with 4 primitive layers, diffuse neuronal heterotopia, enlarged and dysmorphic ventricles, and often hypoplasia of the corpus callosum. Lissencephaly is found in association with facial abnormalities in Miller-Dieker syndrome and without other major anomalies in X-linked lissencephaly and isolated lissencephaly sequence (ILS). Subcortical band heterotopia (SBH) are bilateral and symmetric ribbons of gray matter found in the central white matter between the cortex and the ventricular surface and comprise the less severe end of the lissencephaly spectrum of malformations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for LIS1 Antibody (NBP1-87769) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Verified Customer IF Human 03/25/2015

Summary

• Application: Immunofluorescence
• Sample Tested: Caco-2 cells
• Species: Human

reviewed by: Verified Customer WB Human 03/23/2015

Summary

• Application: Western Blot
• Sample Tested: Caco-2 whole cell lysate
• Species: Human

Bioinformatics

• Gene Symbol: PAFAH1B1