![Western Blot: LIS1 Antibody [NBP1-87769] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/LIS1-Antibody-Western-Blot-NBP1-87769-img0005.jpg "Western Blot: LIS1 Antibody [NBP1-87769] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS |
| Specificity | Specificity of human LIS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PAFAH1B1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. ICC/IF and WB reported in a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
IF | Human | 03/25/2015 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
|
||||||||||||||||||
Enlarge |
reviewed by:
Anonymous |
WB | Human | 03/23/2015 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
|
Secondary Antibodies |
Isotype Controls |
Diseases for LIS1 Antibody (NBP1-87769)Discover more about diseases related to LIS1 Antibody (NBP1-87769).
| Pathways for LIS1 Antibody (NBP1-87769)View related products by pathway.
|
PTMs for LIS1 Antibody (NBP1-87769)Learn more about PTMs related to LIS1 Antibody (NBP1-87769).
| Research Areas for LIS1 Antibody (NBP1-87769)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Anonymous 03/25/2015 |
||
| Application: | IF | |
| Species: | Human |
| Anonymous 03/23/2015 |
||
| Application: | WB | |
| Species: | Human |
| Gene Symbol | PAFAH1B1 |
![Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.](http://images.novusbio.com/fullsize2/LIS1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87769-img0009.jpg "Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.")
![Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.](http://images.novusbio.com/fullsize2/LIS1-Antibody-Immunohistochemistry-Paraffin-NBP1-87769-img0002.jpg "Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.")
![Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image from verified customer review.](http://images.novusbio.com/fullsize2/LIS1-Antibody-Western-Blot-NBP1-87769-img0006.jpg "Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image from verified customer review.")
![Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining LIS1 in Caco-2 cells using anti-LIS1 antibody. Image from verified customer review.](http://images.novusbio.com/fullsize2/LIS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87769-img0007.jpg "Immunocytochemistry/Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining LIS1 in Caco-2 cells using anti-LIS1 antibody. Image from verified customer review.")
![Immunohistochemistry-Paraffin: FANCB Antibody (M38P3E10) [NBP2-52406] - Staining was performed on formalin-fixed, paraffin-embedded human breast cancer tissue sections using anti-FANCB [M38P3E10]. The antibody shows both nuclear and cytoplasmic staining but it is predominately cytoplasmic.](http://images.novusbio.com/fullsize2/FANCB-Antibody-(M38P3E10)-Immunohistochemistry-Paraffin-NBP2-52406-img0001.jpg)
![Western Blot: Doublecortin Antibody (3E1) [NBP1-92684] - Analysis of rat whole brain lysates using mouse mAb to Doublecortin (DCX), NBP1-92684, dilution 1:1,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain. Strong bands at 40, 45kDa correspond to DCX protein, detected only in the developing brain.](http://images.novusbio.com/fullsize2/Doublecortin-Antibody-(3E1)-Western-Blot-NBP1-92684-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Analysis of cortical neuron-glial cell culture from E20 rat stained with mouse mAb to Doublecortin (DCX), NBP1-92684, dilution 1:1,000 in red, and costained with chicken pAb to Microtubule Associated Protein2 (MAP2), dilution 1:10,000 in green. The blue is DAPI staining of nuclear DNA. DCX antibody reveals strong cytoplasmic staining in a population of small developing neurons and their processes, while MAP2 antibody stains dendrites and perikarya of mature neurons. Therefore DCX antibody is an excellent marker of developing neuronal cells.](http://images.novusbio.com/fullsize2/Doublecortin-Antibody-(3E1)-Immunocytochemistry-Immunofluorescence-NBP1-92684-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Rat brain neural cultures stained with NBP1-92684 (green), a chicken polyclonal antibody to GFAP (NB300-213, red) and DNA (blue). The NBP1-92684 antibody reveals strong cytoplasmic staining in a population of small developing neurons. These cells are often found in small clumps as in these cultures, as in this example. Note that they are not positive for MAP2, which is characteristic of more mature neurons, and that the mature neuron shown is negative for NBP1-92684. This Doublecortin antibody is therefore an excellent marker of developing neuronal cells.](http://images.novusbio.com/fullsize2/Doublecortin-Antibody-(3E1)-Immunocytochemistry-Immunofluorescence-NBP1-92684-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).](http://images.novusbio.com/fullsize2/CD34 Antibody (MEC 14.7)-Immunocytochemistry-Immunofluorescence-NB600-1071-img0003.jpg)
![Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.](http://images.novusbio.com/fullsize2/CD34-Antibody-(MEC-14.7)-Immunohistochemistry-Paraffin-NB600-1071-img0014.jpg)
![Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).](http://images.novusbio.com/fullsize2/CD34 Antibody (MEC 14.7)-Flow Cytometry-NB600-1071-img0002.jpg)
![Western Blot: Nudel Antibody (5E11) [NBP2-01086] Analysis of extracts (35ug) from 9 different cell lines by using anti-Nudel monoclonal antibody.](http://images.novusbio.com/fullsize/Nudel Antibody (5E11)-Western Blot-NBP2-01086-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: Nudel Antibody (5E11) [NBP2-01086] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Nudel.](http://images.novusbio.com/fullsize/Nudel Antibody (5E11)-Immunocytochemistry-Immunofluorescence-NBP2-01086-img0008.jpg)
![Immunohistochemistry-Paraffin: Nudel Antibody (5E11) [NBP2-01086] - Staining of paraffin-embedded Human Ovary tissue using anti-Nudel mouse monoclonal antibody.](http://images.novusbio.com/fullsize/Nudel Antibody (5E11)-Immunohistochemistry-Paraffin-NBP2-01086-img0007.jpg)
![Western Blot: MID1 Antibody [NBP1-26612] - Whole cell lysate from HeLa (5, 15 and 50 ug) and 293T (T; 50 ug) cells. Antibody used at 1 ug/ml.](http://images.novusbio.com/fullsize2/MID1-Antibody-Western-Blot-NBP1-26612-img0002.jpg)
![Western Blot: Arginyl tRNA synthetase Antibody [NBP1-88032] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize2/Arginyl-tRNA-synthetase-Antibody-Western-Blot-NBP1-88032-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Arginyl tRNA synthetase Antibody [NBP1-88032] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize2/Arginyl tRNA synthetase Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88032-img0008.jpg)
![Immunohistochemistry-Paraffin: Arginyl tRNA synthetase Antibody [NBP1-88032] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Arginyl-tRNA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-88032-img0007.jpg)
![Western Blot: RUNX1/CBFA2 Antibody (SD0803) [NBP2-67779] - Analysis of RUNX1+RUNX2+RUNX3 on Jurkat cells lysates using anti-RUNX1+RUNX2+RUNX3 antibody at 1/1,000 dilution.](http://images.novusbio.com/fullsize2/RUNX1-CBFA2-Antibody-(SD0803)-Western-Blot-NBP2-67779-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody (SD0803) [NBP2-67779] - Staining RUNX1+RUNX2+RUNX3 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/fullsize2/RUNX1-CBFA2 Antibody (SD0803)-Immunocytochemistry-Immunofluorescence-NBP2-67779-img0007.jpg)
![Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody (SD0803) [NBP2-67779] - Analysis of paraffin-embedded mouse testis tissue using anti-RUNX1+RUNX2+RUNX3 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/fullsize2/RUNX1-CBFA2-Antibody-(SD0803)-Immunohistochemistry-Paraffin-NBP2-67779-img0005.jpg)
![Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Western-Blot-NB200-103-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Immunocytochemistry-Immunofluorescence-NB200-103-img0004.jpg)
![Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Immunohistochemistry-Paraffin-NB200-103-img0005.jpg)
![Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/fullsize2/NOD2-Antibody-(2D9)-Western-Blot-NB100-524-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/NOD2-Antibody-(2D9)-Immunocytochemistry-Immunofluorescence-NB100-524-img0008.jpg)
![Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.](http://images.novusbio.com/fullsize2/NOD2-Antibody-(2D9)-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")