LIS1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Analysis in human testis and liver tissues using NBP1-87769 antibody. Corresponding PAFAH1B1 RNA-seq data are presented for the ...read more
Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining LIS1 in Caco-2 cells using anti-LIS1 antibody. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human cerebellum shows moderate positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

LIS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAFAH1B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. LIS1 antibody validated for ICC/IF, WB from verified customer reviews.
Control Peptide
LIS1 Protein (NBP1-87769PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87769 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIS1 Antibody

  • LIS-1
  • LIS1PAF-AH alpha
  • LIS2
  • lissencephaly 1 protein
  • Lissencephaly-1 protein
  • MDCR
  • MDS
  • Miller-Dieker syndrome chromosome region
  • PAF acetylhydrolase 45 kDa subunit
  • PAF-AH 45 kDa subunit
  • PAFAH alpha
  • PAFAH
  • PAFAHA
  • platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
  • platelet-activating factor acetylhydrolase IB subunit alpha
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD)
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa
  • platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)

Background

Lissencephaly (LIS), literally meaning smooth brain, has multiple causes. Agyria, i.e., brain without convolutions or gyri, was considered a rare malformation until recent progress in neuroradiology. With this technical advantage, a number of lissencephaly syndromes have been distinguished. Classic lissencephaly (type I) is a brain malformation caused by abnormal neuronal migration at 9 to 13 weeks' gestation, resulting in a spectrum of agyria, mixed agyria / pachygyria, and pachygyria. It is characterized by an abnormally thick and poorly organized cortex with 4 primitive layers, diffuse neuronal heterotopia, enlarged and dysmorphic ventricles, and often hypoplasia of the corpus callosum. Lissencephaly is found in association with facial abnormalities in Miller-Dieker syndrome and without other major anomalies in X-linked lissencephaly and isolated lissencephaly sequence (ILS). Subcortical band heterotopia (SBH) are bilateral and symmetric ribbons of gray matter found in the central white matter between the cortex and the ventricular surface and comprise the less severe end of the lissencephaly spectrum of malformations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DPLG70
Species: Hu
Applications: ELISA
MEP00B
Species: Mu
Applications: ELISA
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
AF5129
Species: Hu
Applications: WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MCS00
Species: Mu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
MCS00
Species: Mu
Applications: ELISA
NBP2-01086
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7954-GM/CF
Species: Hu
Applications: BA
203-IL/CF
Species: Hu
Applications: BA
NBP1-87769
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LIS1 Antibody (NBP1-87769) (0)

There are no publications for LIS1 Antibody (NBP1-87769).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIS1 Antibody (NBP1-87769) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-87769:
Filter by Applications
IF
(1)
WB
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence LIS1 NBP1-87769
Enlarge
4
reviewed by:
_Anonymous_ _15_
IF Human 03/25/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedCaco-2 cells
SpeciesHuman
Western Blot LIS1 NBP1-87769
Enlarge
5
reviewed by:
_Anonymous_ _15_
WB Human 03/23/2015
View

Summary

ApplicationWestern Blot
Sample TestedCaco-2 whole cell lysate
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LIS1 Antibody (NBP1-87769) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIS1 Products

Bioinformatics Tool for LIS1 Antibody (NBP1-87769)

Discover related pathways, diseases and genes to LIS1 Antibody (NBP1-87769). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIS1 Antibody (NBP1-87769)

Discover more about diseases related to LIS1 Antibody (NBP1-87769).
 

Pathways for LIS1 Antibody (NBP1-87769)

View related products by pathway.

PTMs for LIS1 Antibody (NBP1-87769)

Learn more about PTMs related to LIS1 Antibody (NBP1-87769).
 

Research Areas for LIS1 Antibody (NBP1-87769)

Find related products by research area.

Blogs on LIS1

There are no specific blogs for LIS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

_Anonymous_ _15_
03/25/2015
Application: IF
Species: Human

_Anonymous_ _15_
03/23/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol PAFAH1B1