Home » LIS1 » LIS1 Antibodies » LIS1 Antibody

LIS1 Antibody

 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Analysis in human testis and liver tissues using NBP1-87769 antibody. Corresponding PAFAH1B1 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Analysis in human testis and liver tissues using NBP1-87769 antibody. Corresponding PAFAH1B1 RNA-seq data are presented for the ...read more
Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining of human cell line U-251 MG shows localization to centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining LIS1 in Caco-2 cells using anti-LIS1 antibody. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human cerebellum shows moderate positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

LIS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAFAH1B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. LIS1 antibody validated for ICC/IF, WB from verified customer reviews.
Control Peptide
LIS1 Protein (NBP1-87769PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87769 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIS1 Antibody

  • LIS-1
  • LIS1PAF-AH alpha
  • LIS2
  • lissencephaly 1 protein
  • Lissencephaly-1 protein
  • MDCR
  • MDS
  • Miller-Dieker syndrome chromosome region
  • PAF acetylhydrolase 45 kDa subunit
  • PAF-AH 45 kDa subunit
  • PAFAH alpha
  • PAFAH
  • PAFAHA
  • platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
  • platelet-activating factor acetylhydrolase IB subunit alpha
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD)
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa
  • platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)

Background

Lissencephaly (LIS), literally meaning smooth brain, has multiple causes. Agyria, i.e., brain without convolutions or gyri, was considered a rare malformation until recent progress in neuroradiology. With this technical advantage, a number of lissencephaly syndromes have been distinguished. Classic lissencephaly (type I) is a brain malformation caused by abnormal neuronal migration at 9 to 13 weeks' gestation, resulting in a spectrum of agyria, mixed agyria / pachygyria, and pachygyria. It is characterized by an abnormally thick and poorly organized cortex with 4 primitive layers, diffuse neuronal heterotopia, enlarged and dysmorphic ventricles, and often hypoplasia of the corpus callosum. Lissencephaly is found in association with facial abnormalities in Miller-Dieker syndrome and without other major anomalies in X-linked lissencephaly and isolated lissencephaly sequence (ILS). Subcortical band heterotopia (SBH) are bilateral and symmetric ribbons of gray matter found in the central white matter between the cortex and the ventricular surface and comprise the less severe end of the lissencephaly spectrum of malformations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


PLA2G7/PAF-AH/Lp-PLA2
DPLG70
(1 Review)
(14 Publications)
Species: Hu
Applications: ELISA
Erythropoietin/EPO
[HRP]
MEP00B
(98 Publications)
Species: Mu
Applications: ELISA
FANCB Antibody
(M38P3E10) - BSA Free
NBP2-52406
Immunohistochemistry-Paraffin: FANCB Antibody (M38P3E10) [NBP2-52406] - Staining was performed on formalin-fixed, paraffin-embedded human breast cancer tissue sections using anti-FANCB [M38P3E10]. The antibody shows both nuclear and cytoplasmic staining but it is predominately cytoplasmic.
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
Doublecortin
Antibody
NBP1-72042
Western Blot: Doublecortin Antibody [NBP1-72042] - staining of Mouse fetal Brain lysate (35 ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (5 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL).
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed KNRK cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CD34 Antibody (MEC
14.7)
NB600-1071
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(24 Publications)
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
G-CSF [HRP]
MCS00
(48 Publications)
Species: Mu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(741 Publications)
Species: Hu
Applications: BA
G-CSF [HRP]
MCS00
(48 Publications)
Species: Mu
Applications: ELISA
Nudel Antibody
(OTI5E11)
NBP2-01086
Flow Cytometry: Nudel Antibody (5E11) [NBP2-01086] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Nudel antibody, and then analyzed by flow cytometry.
Western Blot: Nudel Antibody (5E11) [NBP2-01086] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Nudel (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Nudel.
Immunohistochemistry-Paraffin: Nudel Antibody (5E11) [NBP2-01086] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-Nudel mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MID1 Antibody
NBP3-05061
Immunocytochemistry/Immunofluorescence: MID1 Antibody [NBP3-05061] - Analysis of MCF-7 cells using MID1 antibody . Blue: DAPI for nuclear staining.
Western Blot: MID1 Antibody [NBP3-05061] - analysis of extracts of HeLa cells, using MID1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.
Species: Hu, Mu
Applications: ICC/IF, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 6-30 pg/mL.
(2 Publications)
Species: Hu
Applications: BA
RUNX1/CBFA2
Antibody
NBP1-89105
Immunocytochemistry/Immunofluorescence: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human breast shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RUNX1/CBFA2 Antibody [NBP1-89105] - Staining of human Fallopian tube shows weak to moderate nuclear positivity in glandular cells.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 6-30 pg/mL.
(2 Publications)
Species: Hu
Applications: BA
IL-3 [Unconjugated]
203-IL/CF
1 μg/lane of Recombinant Human IL-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-3 (Catalog #203‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.02‑0.1 ng/mL.
(185 Publications)
Species: Hu
Applications: BA
LIS1 Antibody
NBP1-87769
LIS1 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LIS1 Antibody (NBP1-87769) (0)

There are no publications for LIS1 Antibody (NBP1-87769).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIS1 Antibody (NBP1-87769) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-87769:
Filter by Applications
IF
(1)
WB
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence LIS1 NBP1-87769
Enlarge 		4
reviewed by:
_Anonymous_ _15_
 IF Human 03/25/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedCaco-2 cells
SpeciesHuman
Western Blot LIS1 NBP1-87769
Enlarge 		5
reviewed by:
_Anonymous_ _15_
 WB Human 03/23/2015
View

Summary

ApplicationWestern Blot
Sample TestedCaco-2 whole cell lysate
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LIS1 Antibody (NBP1-87769) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIS1 Products

Bioinformatics Tool for LIS1 Antibody (NBP1-87769)

Discover related pathways, diseases and genes to LIS1 Antibody (NBP1-87769). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIS1 Antibody (NBP1-87769)

Discover more about diseases related to LIS1 Antibody (NBP1-87769).
 

Pathways for LIS1 Antibody (NBP1-87769)

View related products by pathway.

PTMs for LIS1 Antibody (NBP1-87769)

Learn more about PTMs related to LIS1 Antibody (NBP1-87769).
 

Research Areas for LIS1 Antibody (NBP1-87769)

Find related products by research area.

Blogs on LIS1

There are no specific blogs for LIS1, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Immunofluorescence LIS1 NBP1-87769
Enlarge
 _Anonymous_ _15_
03/25/2015
Application: IF
Species: Human
read this review
Western Blot LIS1 NBP1-87769
Enlarge
 _Anonymous_ _15_
03/23/2015
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol PAFAH1B1