LIS1 Antibody

Images

 
Western Blot: LIS1 Antibody [NBP1-87769] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769] - Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Immunohistochemistry-Paraffin: LIS1 Antibody [NBP1-87769] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
Western Blot: LIS1 Antibody [NBP1-87769] - Analysis of LIS1 in caco-2 whole cell lysate using anti-LIS1 antibody. Image from verified customer review.
Immunocytochemistry/ Immunofluorescence: LIS1 Antibody [NBP1-87769] - Staining LIS1 in Caco-2 cells using anti-LIS1 antibody. Image from verified customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAFAH1B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LIS1 Protein (NBP1-87769PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87769 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIS1 Antibody

  • LIS-1
  • LIS1PAF-AH alpha
  • LIS2
  • lissencephaly 1 protein
  • Lissencephaly-1 protein
  • MDCR
  • MDS
  • Miller-Dieker syndrome chromosome region
  • PAF acetylhydrolase 45 kDa subunit
  • PAF-AH 45 kDa subunit
  • PAFAH alpha
  • PAFAH
  • PAFAHA
  • platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
  • platelet-activating factor acetylhydrolase IB subunit alpha
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD)
  • platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa
  • platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for LIS1 Antibody (NBP1-87769) (0)

There are no publications for LIS1 Antibody (NBP1-87769).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIS1 Antibody (NBP1-87769) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.
We have 2 reviews tested in 2 application: IF, WB.

Reviews using NBP1-87769:
Filter by Applications
IF
(1)
WB
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence LIS1 NBP1-87769
Enlarge
reviewed by:
Anonymous
IF Human 03/25/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedCaco-2 cells
SpeciesHuman

Blocking

Blocking DetailsNo blocking

Primary Anitbody

Dilution Ratio1/100 dilution in 1xPBS, 1 hour at RT

Secondary Antibody

Secondary DescriptionCy3 anti-rabbit

Details

Detection NotesImmunoflourescence microscopy
Fixation DetailsFormaldehyde fixation
Wash Description3x washing in 1xPBS
Western Blot LIS1 NBP1-87769
Enlarge
reviewed by:
Anonymous
WB Human 03/23/2015
View

Summary

ApplicationWestern Blot
Sample TestedCaco-2 whole cell lysate
SpeciesHuman

Blocking

Blocking Details1 hour, 5% dry milk powder solution in 1xPBS, at room temperature

Primary Anitbody

Dilution Ratio1:250, overnight at 4C

Secondary Antibody

Secondary DescriptionHRP

Details

Detection NotesEnhanced chemiluminescence (ECL) detection method, exposure time: 30 sec - 1 min

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LIS1 Antibody (NBP1-87769) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIS1 Products

Bioinformatics Tool for LIS1 Antibody (NBP1-87769)

Discover related pathways, diseases and genes to LIS1 Antibody (NBP1-87769). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIS1 Antibody (NBP1-87769)

Discover more about diseases related to LIS1 Antibody (NBP1-87769).
 

Pathways for LIS1 Antibody (NBP1-87769)

View related products by pathway.

PTMs for LIS1 Antibody (NBP1-87769)

Learn more about PTMs related to LIS1 Antibody (NBP1-87769).
 

Research Areas for LIS1 Antibody (NBP1-87769)

Find related products by research area.

Blogs on LIS1

There are no specific blogs for LIS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Anonymous
03/25/2015
Application: IF
Species: Human

Anonymous
03/23/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol PAFAH1B1