14-3-3 epsilon Antibody

Images

 
Western Blot: 14-3-3 epsilon Antibody [NBP1-89827] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: 14-3-3 epsilon Antibody [NBP1-89827] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: 14-3-3 epsilon Antibody [NBP1-89827] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
Western Blot: 14-3-3 epsilon Antibody [NBP1-89827] - Analysis in human cell line SCLC-21H.
Immunohistochemistry-Paraffin: 14-3-3 epsilon Antibody [NBP1-89827] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunofluorescence: 14-3-3 epsilon Antibody [NBP1-89827] - Staining 14-3-3 epsilon in methanol-fixed, rat primary motor neurons using anti-14-3-3 epsilon antibody (green). Nuclei were stained with DAPI (blue). Image ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

14-3-3 epsilon Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YWHAE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
14-3-3 epsilon Recombinant Protein Antigen (NBP1-89827PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89827 in the following applications:

Publications
Read Publications using
NBP1-89827 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 14-3-3 epsilon Antibody

  • 1433 epsilon
  • 14-3-3 epsilon
  • 14-3-3 protein epsilon
  • FLJ45465
  • FLJ53559,14-3-3E
  • KCIP-1
  • MDCR
  • MDS
  • mitochondrial import stimulation factor L subunit
  • protein kinase C inhibitor protein-1
  • tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilonpolypeptide
  • YWHAE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-88032
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
MAB6798
Species: Hu
Applications: WB, ICC

Publications for 14-3-3 epsilon Antibody (NBP1-89827)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for 14-3-3 epsilon Antibody (NBP1-89827) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.
We have 1 review tested in 1 application: IF.

Reviews using NBP1-89827:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence 14-3-3 epsilon NBP1-89827
Enlarge
reviewed by:
Anonymous
IF Rat 09/24/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedRat primary motor neurons, plated on PDL-coated coverslips
SpeciesRat

Blocking

Blocking DetailsScytek Super-block

Primary Anitbody

Dilution Ratio1:200, 1h at room temperature

Secondary Antibody

Secondary DescriptionAlexafluor anti-rabbit 488
Secondary Manufacturer Cat#Lifetech
Secondary Concentration1:250

Details

Detection NotesPictures taken on Zeiss microscope.
Fixation DetailsFixed for 10min in ice-cold methanol, permeabilized for 4min in 0.2% Tween
Wash Description3 washes in PBS

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 14-3-3 epsilon Antibody (NBP1-89827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 14-3-3 epsilon Products

Bioinformatics Tool for 14-3-3 epsilon Antibody (NBP1-89827)

Discover related pathways, diseases and genes to 14-3-3 epsilon Antibody (NBP1-89827). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 14-3-3 epsilon Antibody (NBP1-89827)

Discover more about diseases related to 14-3-3 epsilon Antibody (NBP1-89827).
 

Pathways for 14-3-3 epsilon Antibody (NBP1-89827)

View related products by pathway.

PTMs for 14-3-3 epsilon Antibody (NBP1-89827)

Learn more about PTMs related to 14-3-3 epsilon Antibody (NBP1-89827).
 

Research Areas for 14-3-3 epsilon Antibody (NBP1-89827)

Find related products by research area.

Blogs on 14-3-3 epsilon

There are no specific blogs for 14-3-3 epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
09/24/2015
Application: IF
Species: Rat

Bioinformatics

Gene Symbol YWHAE
Entrez