14-3-3 epsilon Antibody

Western Blot: 14-3-3 epsilon Antibody [NBP1-89827] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: 14-3-3 epsilon Antibody [NBP1-89827] - Staining 14-3-3 epsilon in methanol-fixed, rat primary motor neurons using anti-14-3-3 epsilon antibody (green). Nuclei were stained with DAPI (blue). Image from verified customer review.

Immunohistochemistry-Paraffin: 14-3-3 epsilon Antibody [NBP1-89827] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Western Blot: 14-3-3 epsilon Antibody [NBP1-89827] - Analysis in human cell line SCLC-21H.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

14-3-3 epsilon Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: YWHAE
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. ICC/IF reported in verified customer review.
• Control Peptide:

  14-3-3 epsilon Recombinant Protein Antigen (NBP1-89827PEP)

Reactivity Notes

Rat reactivity reported in a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for 14-3-3 epsilon Antibody

• 1433 epsilon
• 14-3-3 epsilon
• 14-3-3 protein epsilon
• FLJ45465
• FLJ53559,14-3-3E
• KCIP-1
• MDCR
• MDS
• mitochondrial import stimulation factor L subunit
• protein kinase C inhibitor protein-1
• tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide
• tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilonpolypeptide
• YWHAE

Background

14-3-3 epsilon product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for 14-3-3 epsilon Antibody (NBP1-89827)(2)

Publications using NBP1-89827

• Dowling P, Hughes DJ, Larkin AM et al. Elevated levels of 14-3-3 proteins, serotonin, gamma enolase and pyruvate kinase identified in clinical samples from patients diagnosed with colorectal cancer. Clin. Chim. Acta. 2014-12-23 [PMID: 25540887] (IHC-P, Human)
• Lee CH, Ou WB, Marino-Enriquez A et al. 14-3-3 fusion oncogenes in high-grade endometrial stromal sarcoma. Proc Natl Acad Sci U S A 2012-01-01 [PMID: 22223660]

Review for 14-3-3 epsilon Antibody (NBP1-89827) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Nadine Bakkar IF Rat 09/24/2015

Summary

• Application: Immunofluorescence
• Sample Tested: Rat primary motor neurons, plated on PDL-coated coverslips
• Species: Rat

Bioinformatics

• Gene Symbol: YWHAE