14-3-3 epsilon Antibody

Images

 
Western Blot: 14-3-3 epsilon Antibody [NBP1-89827] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: 14-3-3 epsilon Antibody [NBP1-89827] - Staining 14-3-3 epsilon in methanol-fixed, rat primary motor neurons using anti-14-3-3 epsilon antibody (green). Nuclei were stained with ...read more
Immunohistochemistry-Paraffin: 14-3-3 epsilon Antibody [NBP1-89827] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
Western Blot: 14-3-3 epsilon Antibody [NBP1-89827] - Analysis in human cell line SCLC-21H.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

14-3-3 epsilon Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YWHAE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence - Reported from a verified customer review.
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
14-3-3 epsilon Recombinant Protein Antigen (NBP1-89827PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89827 in the following applications:

Publications
Read Publications using
NBP1-89827 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 14-3-3 epsilon Antibody

  • 1433 epsilon
  • 14-3-3 epsilon
  • 14-3-3 protein epsilon
  • FLJ45465
  • FLJ53559,14-3-3E
  • KCIP-1
  • MDCR
  • MDS
  • mitochondrial import stimulation factor L subunit
  • protein kinase C inhibitor protein-1
  • tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilonpolypeptide
  • YWHAE

Background

14-3-3 epsilon product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for 14-3-3 epsilon Antibody (NBP1-89827)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for 14-3-3 epsilon Antibody (NBP1-89827) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-89827:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence 14-3-3 epsilon NBP1-89827
Enlarge
5
reviewed by:
Verified Customer
IF Rat 09/24/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedRat primary motor neurons, plated on PDL-coated coverslips
SpeciesRat

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 14-3-3 epsilon Antibody (NBP1-89827) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 14-3-3 epsilon Products

Research Areas for 14-3-3 epsilon Antibody (NBP1-89827)

Find related products by research area.

Blogs on 14-3-3 epsilon

There are no specific blogs for 14-3-3 epsilon, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
09/24/2015
Application: IF
Species: Rat

Bioinformatics

Gene Symbol YWHAE