Bcl-xL Antibody - BSA Free

Western Blot: Bcl-xL Antibody [NBP2-38262] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: Bcl-xL Antibody [NBP2-38262] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Bcl-xL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Bcl-xL Antibody - BSA Free (NBP2-38262) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCL2L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Bcl-xL Protein (NBP2-38262PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Bcl-xL Antibody - BSA Free

• Apoptosis regulator Bcl-X
• bcl2-L-1
• BCL2-like 1
• bcl-2-like protein 1
• BCLXBCL2LBcl-X
• BclxL
• Bcl-xL
• BCL-XL/S
• BCLXS
• bcl-xS
• DKFZp781P2092

Background

Bcl-x, a member of the Bcl-2 protein family, inhibits cell death, or apoptosis (1). Bcl-x is expressed as two isomeric forms, Bcl-xL and Bcl-xS, and is typically present in the cytosol in association with the mitochondrial membrane. Bcl-xL forms heterodimers with various proteins, including Bax, Bak and Bcl-2 (2). It has been found that eterodimerization with Bax does not seem to be required for anti-apoptotic activity (3). Since Bcl-xL can form an ion channel in synthetic lipid membranes, there is a strong possibility that this property plays a role in heterodimerization-independent cell survival (4). The Bcl-X(S) isoform promotes apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL2L1
• Uniprot:
  • Q07817()