BAAT Antibody

Images

 
Western Blot: BAAT Antibody [NBP2-14344] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: BAAT Antibody [NBP2-14344] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHY RANEFGEVDLNHASSLGGDYMGVH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BAAT Protein (NBP2-14344PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BAAT Antibody

  • BACAT
  • BATbile acid-CoA:amino acid N-acyltransferase
  • bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
  • bile acid Coenzyme A: amino acid N-acyltransferase (glycineN-choloyltransferase)
  • EC 2.3.1.65
  • EC 3.1.2.2
  • FLJ20300
  • Glycine N-choloyltransferase
  • Long-chain fatty-acyl-CoA hydrolase
  • MGC104432

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88813
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB5826
Species: Hu
Applications: WB, IHC
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P

Publications for BAAT Antibody (NBP2-14344) (0)

There are no publications for BAAT Antibody (NBP2-14344).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAAT Antibody (NBP2-14344) (0)

There are no reviews for BAAT Antibody (NBP2-14344). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAAT Antibody (NBP2-14344) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAAT Products

Bioinformatics Tool for BAAT Antibody (NBP2-14344)

Discover related pathways, diseases and genes to BAAT Antibody (NBP2-14344). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAAT Antibody (NBP2-14344)

Discover more about diseases related to BAAT Antibody (NBP2-14344).
 

Pathways for BAAT Antibody (NBP2-14344)

View related products by pathway.

PTMs for BAAT Antibody (NBP2-14344)

Learn more about PTMs related to BAAT Antibody (NBP2-14344).

Blogs on BAAT

There are no specific blogs for BAAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BAAT