BAAT Antibody - BSA Free

Immunohistochemistry-Paraffin: BAAT Antibody [NBP2-14344] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BAAT Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BAAT Antibody - BSA Free (NBP2-14344) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDLNHASSLGGDYMGVH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BAAT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BAAT Protein (NBP2-14344PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BAAT Antibody - BSA Free

• BACAT
• BATbile acid-CoA:amino acid N-acyltransferase
• bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
• bile acid Coenzyme A: amino acid N-acyltransferase (glycineN-choloyltransferase)
• EC 2.3.1.65
• EC 3.1.2.2
• FLJ20300
• Glycine N-choloyltransferase
• Long-chain fatty-acyl-CoA hydrolase
• MGC104432

Background

BAAT is encoded by this gene is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The bile acid conjugates then act as a detergent in the gastrointestinal tract, which enhances lipid and fat-soluble vitamin absorption. Defects in this gene are a cause of familial hypercholanemia (FHCA). Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BAAT