Plastin L Antibody


Western Blot: Plastin L Antibody [NBP1-88057] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-434
Immunocytochemistry/ Immunofluorescence: Plastin L Antibody [NBP1-88057] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and actin filaments.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] - Staining in human spleen and skeletal muscle tissues using anti-LCP1 antibody. Corresponding LCP1 RNA-seq data are presented more
Western Blot: Plastin L Antibody [NBP1-88057] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] - Staining of human spleen shows high expression.

Product Details

Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Plastin L Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
Specificity of human, rat Plastin L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Read Publication using NBP1-88057.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Plastin L Antibody

  • CP64
  • DKFZp781A23186
  • FLJ25423
  • FLJ26114
  • FLJ39956
  • LC64PPLS2bA139H14.1 (lymphocyte cytosolic protein 1 (L-plastin))
  • LCP-1
  • LPL
  • L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (LC64P)
  • lymphocyte cytosolic protein 1 (L-plastin)
  • Lymphocyte cytosolic protein 1
  • Lymphocyte cytosolic protein-1 (plasmin)
  • plastin 2
  • plastin-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
Species: Hu, Bv, Rb
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu(-)
Applications: WB, ICC/IF, IHC-Fr

Publications for Plastin L Antibody (NBP1-88057)(1)

Reviews for Plastin L Antibody (NBP1-88057) (0)

There are no reviews for Plastin L Antibody (NBP1-88057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Plastin L Antibody (NBP1-88057). (Showing 1 - 1 of 1 FAQ).

  1. What is the concentration of lot# R10186?
    • Lot number R10186 of our LCP1 antibody with catalogue number NBP1-88057 is provided at a concentration of 1mg/ml.

Secondary Antibodies


Isotype Controls

Additional Plastin L Products

Bioinformatics Tool for Plastin L Antibody (NBP1-88057)

Discover related pathways, diseases and genes to Plastin L Antibody (NBP1-88057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plastin L Antibody (NBP1-88057)

Discover more about diseases related to Plastin L Antibody (NBP1-88057).

Pathways for Plastin L Antibody (NBP1-88057)

View related products by pathway.

PTMs for Plastin L Antibody (NBP1-88057)

Learn more about PTMs related to Plastin L Antibody (NBP1-88057).

Blogs on Plastin L

There are no specific blogs for Plastin L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Plastin L Antibody and receive a gift card or discount.


Gene Symbol LCP1