Plastin L Antibody - BSA Free

Western Blot: Plastin L Antibody [NBP1-88057] -Analysis in human cell line HEK 293 and human cell line HeLa.

Immunocytochemistry/Immunofluorescence: Plastin L Antibody [NBP1-88057] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and actin filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] - Staining of human spleen shows high expression.

Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] -Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.

Analysis in human cell line HEK 293 and human cell line HeLa.

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Analysis in rat cell line NBT-II.

Staining of human testis shows no cytoplasmic positivity in cells in seminiferous ducts as expected.

Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Plastin L Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
• Predicted Species: Mouse (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Plastin L Protein (NBP1-88057PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Plastin L Antibody - BSA Free

• CP64
• DKFZp781A23186
• FLJ25423
• FLJ26114
• FLJ39956
• LC64PPLS2bA139H14.1 (lymphocyte cytosolic protein 1 (L-plastin))
• LCP-1
• LPL
• L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (LC64P)
• L-PLASTIN
• lymphocyte cytosolic protein 1 (L-plastin)
• Lymphocyte cytosolic protein 1
• Lymphocyte cytosolic protein-1 (plasmin)
• plastin 2
• plastin-2

Background

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Plastin L Antibody (NBP1-88057)(1)

Publication using NBP1-88057

• Bachmann J, Burte F, Pramana S et al. Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria. PLoS Pathog 2014-04-01 [PMID: 24743550]

FAQs for Plastin L Antibody (NBP1-88057). (Showing 1 - 1 of 1 FAQ).

1. What is the concentration of lot# R10186?
   • Lot number R10186 of our LCP1 antibody with catalogue number NBP1-88057 is provided at a concentration of 1mg/ml.

Bioinformatics

• Gene Symbol: LCP1