Plastin L Antibody

Images

 
Western Blot: Plastin L Antibody [NBP1-88057] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-434
Immunocytochemistry/ Immunofluorescence: Plastin L Antibody [NBP1-88057] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments.
Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] - Staining of human spleen shows strong cytoplasmic positivity in cells of white pulp.
Western Blot: Plastin L Antibody [NBP1-88057] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Plastin L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Plastin L Protein (NBP1-88057PEP)
Publications
Read Publication using NBP1-88057.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Plastin L Antibody

  • CP64
  • DKFZp781A23186
  • FLJ25423
  • FLJ26114
  • FLJ39956
  • LC64PPLS2bA139H14.1 (lymphocyte cytosolic protein 1 (L-plastin))
  • LCP-1
  • LPL
  • L-plastin (Lymphocyte cytosolic protein 1) (LCP-1) (LC64P)
  • L-PLASTIN
  • lymphocyte cytosolic protein 1 (L-plastin)
  • Lymphocyte cytosolic protein 1
  • Lymphocyte cytosolic protein-1 (plasmin)
  • plastin 2
  • plastin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12547
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF4497
Species: Hu
Applications: WB, Simple Western
NB600-610
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF

Publications for Plastin L Antibody (NBP1-88057)(1)

Reviews for Plastin L Antibody (NBP1-88057) (0)

There are no reviews for Plastin L Antibody (NBP1-88057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Plastin L Antibody (NBP1-88057). (Showing 1 - 1 of 1 FAQ).

  1. What is the concentration of lot# R10186?
    • Lot number R10186 of our LCP1 antibody with catalogue number NBP1-88057 is provided at a concentration of 1mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional Plastin L Products

Bioinformatics Tool for Plastin L Antibody (NBP1-88057)

Discover related pathways, diseases and genes to Plastin L Antibody (NBP1-88057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plastin L Antibody (NBP1-88057)

Discover more about diseases related to Plastin L Antibody (NBP1-88057).
 

Pathways for Plastin L Antibody (NBP1-88057)

View related products by pathway.

PTMs for Plastin L Antibody (NBP1-88057)

Learn more about PTMs related to Plastin L Antibody (NBP1-88057).

Blogs on Plastin L

There are no specific blogs for Plastin L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plastin L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCP1