B7-1/CD80 Antibody

Images

 
Immunohistochemistry-Paraffin: B7-1/CD80 Antibody [NBP2-48954] - Staining of human tonsil shows high expression.
Immunohistochemistry-Paraffin: B7-1/CD80 Antibody [NBP2-48954] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: B7-1/CD80 Antibody [NBP2-48954] - Staining in human tonsil and pancreas tissues using anti-CD80 antibody. Corresponding CD80 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

B7-1/CD80 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG
Specificity
Specificity of human B7-1/CD80 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
B7-1/CD80 Recombinant Protein Antigen (NBP2-48954PEP)
Publications
Read Publication using
NBP2-48954 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for B7-1/CD80 Antibody

  • Activation B7-1 antigen
  • B7
  • B71
  • B7-1
  • BB1
  • CD28LG1
  • CD28LGB7-1 antigen)
  • CD80 antigen
  • CD80 molecule
  • CD80
  • costimulatory factor CD80
  • costimulatory molecule variant IgV-CD80
  • CTLA-4 counter-receptor B7.1
  • T-lymphocyte activation antigen CD80

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
6507-IL/CF
Species: Hu
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
796-IC
Species: Mu
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
AF1437
Species: Mu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC

Publications for B7-1/CD80 Antibody (NBP2-48954)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for B7-1/CD80 Antibody (NBP2-48954) (0)

There are no reviews for B7-1/CD80 Antibody (NBP2-48954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for B7-1/CD80 Antibody (NBP2-48954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for B7-1/CD80 Antibody (NBP2-48954)

Discover related pathways, diseases and genes to B7-1/CD80 Antibody (NBP2-48954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B7-1/CD80 Antibody (NBP2-48954)

Discover more about diseases related to B7-1/CD80 Antibody (NBP2-48954).
 

Pathways for B7-1/CD80 Antibody (NBP2-48954)

View related products by pathway.

PTMs for B7-1/CD80 Antibody (NBP2-48954)

Learn more about PTMs related to B7-1/CD80 Antibody (NBP2-48954).
 

Research Areas for B7-1/CD80 Antibody (NBP2-48954)

Find related products by research area.

Blogs on B7-1/CD80.

CD80: A co-stimulator of T cell activation
CD80 is a 60kD single chain type I transmembrane glycoprotein that is a member of the immunoglobulin family. CD80 is expressed on activated B- and T-lymphocytes, as well as a subpopulation of previously activated B-cells, but not on the majority of re...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B7-1/CD80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD80