B7-1/CD80 Antibody - BSA Free

Immunohistochemistry-Paraffin: B7-1/CD80 Antibody [NBP2-48954] - Staining in human tonsil and pancreas tissues using anti-CD80 antibody. Corresponding CD80 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: B7-1/CD80 Antibody [NBP2-48954] - Staining of human tonsil shows high expression.

Immunohistochemistry-Paraffin: B7-1/CD80 Antibody [NBP2-48954] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

B7-1/CD80 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit B7-1/CD80 Antibody - BSA Free (NBP2-48954) is a polyclonal antibody validated for use in IHC. Anti-B7-1/CD80 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD80
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  B7-1/CD80 Recombinant Protein Antigen (NBP2-48954PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for B7-1/CD80 Antibody - BSA Free

• Activation B7-1 antigen
• B7
• B71
• B7-1
• BB1
• CD28LG1
• CD28LGB7-1 antigen)
• CD80 antigen
• CD80 molecule
• CD80
• costimulatory factor CD80
• costimulatory molecule variant IgV-CD80
• CTLA-4 counter-receptor B7.1
• T-lymphocyte activation antigen CD80

Background

The B-lymphocyte activation antigen B7-1 (CD80) provides regulatory signals for T lymphocytes as a consequence of binding to the CD28 and CTLA4 ligands of T cells. After engagement of T-cell receptor with antigen in association with major histocompatibility complex class II, a second signal mediated through the binding of B7 to CD28 greatly upregulates the production of multiple lymphokines (1). The relatively small CTLA-4/B7-1 binding interface exhibits an unusually high degree of shape complementarity. CTLA-4 forms homodimers through a newly defined interface of highly conserved residues. This zipper-like oligomerization provides the structural basis for forming unusually stable signalling complexes at the T-cell surface, underscoring the importance of potent inhibitory signalling in human immune responses (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for B7-1/CD80 Antibody (NBP2-48954)(1)

Publication using NBP2-48954

• Kaiser U, Loeffler KU, Nadal J et al. Polarization and distribution of tumor-associated macrophages and COX-2 expression in basal cell carcinoma of the ocular adnexae Curr. Eye Res. 2018-05-18 [PMID: 29775390] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: CD80