| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD80 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-48954 | Applications | Species |
|---|---|---|
| Kaiser U, Loeffler KU, Nadal J et al. Polarization and distribution of tumor-associated macrophages and COX-2 expression in basal cell carcinoma of the ocular adnexae Curr. Eye Res. 2018-05-18 [PMID: 29775390] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for B7-1/CD80 Antibody (NBP2-48954)Find related products by research area.
|
|
CD80: A co-stimulator of T cell activation CD80 is a 60kD single chain type I transmembrane glycoprotein that is a member of the immunoglobulin family. CD80 is expressed on activated B- and T-lymphocytes, as well as a subpopulation of previously activated B-cells, but not on the majority of re... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD80 |