ATP5A Antibody - BSA Free

Simple Western: ATP5A Antibody [NBP2-92928] - ATP5A Antibodies (NBP2-92928), ProteinSimple Western Blot on Jess Instrument. One microgram of human brain tissue lysate was tested with the antibodies diluted 1:10 or 1:20 times. Image from verified customer review.

Western Blot: ATP5A Antibody [NBP2-92928] - Analysis of extracts of various cell lines, using ATP5A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] - Confocal immunofluorescence analysis of Hela cells using ATP5A Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: ATP5A Antibody - BSA Free [NBP2-92928] - Confocal immunofluorescence analysis of U-2OS cells using ATP5A Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP5A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATP5A Antibody - BSA Free (NBP2-92928) is a polyclonal antibody validated for use in WB, ELISA, ICC/IF and Simple Western. Anti-ATP5A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ATP5A1 (NP_004037.1). MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP5F1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Simple Western
  • Western Blot 1:500 - 1:1000
• Application Notes: See Simple Western Antibody Database for Simple Western validation
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATP5A Antibody - BSA Free

• ATP synthase alpha chain, mitochondrial
• ATP synthase subunit alpha, mitochondrial
• ATP synthase, H+ transporting, mitochondrial F1 co
• ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1
• ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle
• ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2
• ATP sythase (F1-ATPase) alpha subunit
• ATP5A
• ATP5A1
• ATP5AL2
• ATP5AMOM2
• ATPM
• ATPMATP synthase subunit alpha, mitochondrial
• cardiac muscle
• COXPD22
• EC 3.6.3
• EC 3.6.3.14
• epididymis secretory sperm binding protein Li 123m
• hATP1
• HEL-S-123m
• MC5DN4
• MC5DN4A
• MC5DN4B
• mitochondrial ATP synthetase, oligomycin-resistant
• MOM2
• OMR
• ORM
• ORMATP synthase alpha chain, mitochondrial

Background

ATP5A encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the same protein have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATP5A Antibody (NBP2-92928)(1)

Publication using NBP2-92928

• de Weerd S, Ruiter EA, Calicchia E et al. Optimization of Cell Membrane Purification for the Preparation and Characterization of Cell Membrane Liposomes. Small methods 2024-10-21 [PMID: 39431332]

Review for ATP5A Antibody (NBP2-92928) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer Simple Western Human 04/06/2023

Summary

• Application: Simple Western
• Sample Tested: human brain lysate
• Species: Human
• Lot: 0025060101

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: ATP5F1A