APP Antibody

Immunohistochemistry-Paraffin: APP Antibody [NBP1-90246] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding APP RNA-seq data are presented for the same tissues.

Western Blot: APP Antibody [NBP1-90246] - Analysis in control (vector only transfected HEK293T lysate) and APP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: APP Antibody [NBP1-90246] - Staining of human hippocampus shows moderate granular positivity in cytoplasm in neurons.

Immunohistochemistry-Paraffin: APP Antibody [NBP1-90246] - Staining of human cerebellum shows moderate granular positivity in cytoplasm in Purkinje cells.

Immunohistochemistry-Paraffin: APP Antibody [NBP1-90246] - Staining of human cerebral cortex shows moderate granular positivity in cytoplasm in neurons.

Immunohistochemistry-Paraffin: APP Antibody [NBP1-90246] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

APP Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  APP Protein (NBP1-90246PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20124221)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for APP Antibody

• amyloid beta (A4) precursor protein-binding, family B, member 2
• amyloid beta A4 precursor protein-binding family B member 2
• Amyloid beta precursor protein
• Amyloid beta
• APP
• beta Amyloid
• Protease Nexin II

Background

A large body of evidence has implicated the amyloid precursor protein (APP) in the pathogenesis of Alzheimer's disease (AD). The phosphorylation APP at Thr668 is thought to play a critical role in generation of the soluble APP (beta) and beta-amyloid peptide (abeta) which are the major components of senile plaques in patient brains inflicted with AD.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for APP Antibody (NBP1-90246)(1)

Publication using NBP1-90246

• Wu CC, Hsu CW, Chen CD et al. Candidate Serological Biomarkers for Cancer Identified from the Secretomes of 23 Cancer Cell Lines and the Human Protein Atlas. Mol Cell Proteomics 2010-06-01 [PMID: 20124221]

Bioinformatics

• Gene Symbol: APP