APP Antibody - BSA Free

Images

 
Orthogonal Strategies: Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-90246 antibody. Corresponding APP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: APP Antibody [NBP1-90246] - Staining of human cerebral cortex shows moderate granular positivity in cytoplasm in neurons.
Immunohistochemistry-Paraffin: APP Antibody [NBP1-90246] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: APP Antibody [NBP1-90246] - Staining of human hippocampus shows moderate granular positivity in cytoplasm in neurons.
Immunohistochemistry-Paraffin: APP Antibody [NBP1-90246] - Staining of human cerebellum shows moderate granular positivity in cytoplasm in Purkinje cells.
Analysis in control (vector only transfected HEK293T lysate) and APP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

APP Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit APP Antibody - BSA Free (NBP1-90246) is a polyclonal antibody validated for use in IHC and WB. Anti-APP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
APP Protein (NBP1-90246PEP)
Publications
Read Publication using NBP1-90246.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20124221)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for APP Antibody - BSA Free

  • amyloid beta (A4) precursor protein-binding, family B, member 2
  • amyloid beta A4 precursor protein-binding family B member 2
  • Amyloid beta precursor protein
  • Amyloid beta
  • APP
  • beta Amyloid
  • Protease Nexin II

Background

A large body of evidence has implicated the amyloid precursor protein (APP) in the pathogenesis of Alzheimer's disease (AD). The phosphorylation APP at Thr668 is thought to play a critical role in generation of the soluble APP (beta) and beta-amyloid peptide (abeta) which are the major components of senile plaques in patient brains inflicted with AD.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
MAB931
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-74513
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF6457
Species: Hu
Applications: WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NB100-56605
Species: Av, Bv, Sh
Applications: WB

Publications for APP Antibody (NBP1-90246)(1)

Reviews for APP Antibody (NBP1-90246) (0)

There are no reviews for APP Antibody (NBP1-90246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APP Antibody (NBP1-90246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APP Products

Research Areas for APP Antibody (NBP1-90246)

Find related products by research area.

Blogs on APP. Showing 1-10 of 12 blog posts - Show all blog posts.

HIV-associated neurocognitive disorders involve extracellular Nef-induced modification of lipid rafts and redistribution of Alzheimer’s disease-related proteins
Jamshed Arslan, Pharm D, PhD Cholesterol is an essential part of animal cell membranes. Cholesterol-rich lipid rafts maintain the fluidity and protein trafficking of plasma membranes. Cellular ABCA1 protein moves cho...  Read full blog post.

Mechanisms of Neurodegeneration: Protein aggregation and failure of autophagy
By Michalina Hanzel, PhDIn a series of three blog posts I will briefly explore the major cellular mechanisms responsible for many neurodegenerative disorders. The first, and perhaps the most apparent, is the accumulat...  Read full blog post.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Lysosomal Dysfunction is Linked to Exosomal Secretion
By Christina Towers, PhD. Lysosomal Dysfunction and DiseaseLysosomes are highly acidic organelles that are critical for cellular function and indispensable for degradative pathways like autophagy and endocytosis....  Read full blog post.

Immunity’s flipside: Microglia promote Alzheimer’s pathology during inflammation
By Jamshed Arslan Pharm.D. Microglia are brain's macrophages. In Alzheimer's disease (AD), microglia clear up protein aggregates called amyloid beta plaques. The connection between immune activation and AD is unclea...  Read full blog post.

The C99 fragment of amyloid precursor protein (APP)
Alzheimer’s Disease (AD) is a neurodegenerative disorder that is characterized by an abundance of the beta-amyloid peptide in the brain.  When AD was first discovered, it was determined that beta-amyloid was produced as a result of the prote...  Read full blog post.

Beta Amyloid (MOAB2) and the link between traumatic brain injury and Alzheimer’s disease
An epidemiological association between traumatic brain injury (TBI) and Alzheimer's disease (AD) has long been established.  Interestingly, an increase in beta amyloid  (one hallmark of AD) directly following TBI has been observed.  In fact, it h...  Read full blog post.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

FANCD2 and DNA damage repair
Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t...  Read full blog post.

Beta Amyloid Neurotoxicity and Alzheimer's Disease
A major histopathological hallmark of Alzheimer's disease (AD) is the presence of amyloid deposits in the parenchyma of the amygdala, hippocampus, and neocortex. The principal component of amyloid is beta amyloid (AB). The pathologic accumulation of A...  Read full blog post.

Showing 1-10 of 12 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APP Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol APP