Angiopoietin-1 Antibody


Immunohistochemistry-Paraffin: Angiopoietin-1 Antibody [NBP1-90170] - Staining of human seminal vesicle shows high expression.
Immunohistochemistry-Paraffin: Angiopoietin-1 Antibody [NBP1-90170] - Staining of human colon shows strong cytoplasmic positivity.
Immunohistochemistry-Paraffin: Angiopoietin-1 Antibody [NBP1-90170] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Angiopoietin-1 Antibody [NBP1-90170] - Staining in human seminal vesicle and pancreas tissues using anti-ANGPT1 antibody. Corresponding ANGPT1 RNA-seq data are presented for the same more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Angiopoietin-1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFR
Specificity of human Angiopoietin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Angiopoietin-1 Protein (NBP1-90170PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Angiopoietin-1 Antibody

  • AGP1
  • AGPT
  • Ang1
  • ANG-1
  • angiopoietin 1
  • Angiopoietin-1
  • ANGPT1
  • KIAA0003


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC, Block
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, Block
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ELISA
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Angiopoietin-1 Antibody (NBP1-90170) (0)

There are no publications for Angiopoietin-1 Antibody (NBP1-90170).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Angiopoietin-1 Antibody (NBP1-90170) (0)

There are no reviews for Angiopoietin-1 Antibody (NBP1-90170). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Angiopoietin-1 Antibody (NBP1-90170) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Angiopoietin-1 Products

Bioinformatics Tool for Angiopoietin-1 Antibody (NBP1-90170)

Discover related pathways, diseases and genes to Angiopoietin-1 Antibody (NBP1-90170). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Angiopoietin-1 Antibody (NBP1-90170)

Discover more about diseases related to Angiopoietin-1 Antibody (NBP1-90170).

Pathways for Angiopoietin-1 Antibody (NBP1-90170)

View related products by pathway.

PTMs for Angiopoietin-1 Antibody (NBP1-90170)

Learn more about PTMs related to Angiopoietin-1 Antibody (NBP1-90170).

Research Areas for Angiopoietin-1 Antibody (NBP1-90170)

Find related products by research area.

Blogs on Angiopoietin-1

There are no specific blogs for Angiopoietin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Angiopoietin-1 Antibody and receive a gift card or discount.


Gene Symbol ANGPT1