AMPK alpha 2 Antibody


Western Blot: AMPK alpha 2 Antibody [NBP1-56322] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Western Blot: AMPK alpha 2 Antibody [NBP1-56322] - Sample Type: rat hepatocyte (50ug) Priamry Dilution: 1:4000 Secondary Antibody: Donkey anti-Rabbit HRP Secondary Dilution: 1:10,000 Image Submitted By: Dustin Singer, more
Western Blot: AMPK alpha 2 Antibody [NBP1-56322] - Middle region validated by WB using Rat Liver, Human Muscle, Rat Muscle, Mouse Muscle at 1:1000.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB

Order Details

AMPK alpha 2 Antibody Summary

Synthetic peptide directed towards the middle region of human PRKAA2 (NP_006243). Peptide sequence: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP.
This product is specific to Subunit or Isofrom: alpha-2.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PRKAA2 and was validated on Western blot.
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AMPK alpha 2 Antibody

  • 5'-AMP-activated protein kinase catalytic subunit alpha-2
  • AMPK alpha 2
  • AMPK subunit alpha-2
  • AMPK2
  • AMPK5'-AMP-activated protein kinase, catalytic alpha-2 chain
  • AMPK-alpha-2 chain
  • EC 2.7.11
  • EC
  • PRKAA2
  • protein kinase, AMP-activated, alpha 2 catalytic subunit


The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB

Publications for AMPK alpha 2 Antibody (NBP1-56322) (0)

There are no publications for AMPK alpha 2 Antibody (NBP1-56322).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK alpha 2 Antibody (NBP1-56322) (0)

There are no reviews for AMPK alpha 2 Antibody (NBP1-56322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMPK alpha 2 Antibody (NBP1-56322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional AMPK alpha 2 Products

Bioinformatics Tool for AMPK alpha 2 Antibody (NBP1-56322)

Discover related pathways, diseases and genes to AMPK alpha 2 Antibody (NBP1-56322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPK alpha 2 Antibody (NBP1-56322)

Discover more about diseases related to AMPK alpha 2 Antibody (NBP1-56322).

Pathways for AMPK alpha 2 Antibody (NBP1-56322)

View related products by pathway.

PTMs for AMPK alpha 2 Antibody (NBP1-56322)

Learn more about PTMs related to AMPK alpha 2 Antibody (NBP1-56322).

Research Areas for AMPK alpha 2 Antibody (NBP1-56322)

Find related products by research area.

Blogs on AMPK alpha 2.

AMPK Alpha 1 and lipid metabolism of adipocytes
AMP-activated protein kinase (AMPK) is best known as a sensor of oxidative stress.  AMPK is activated by increased intracellular AMP levels, which are a result of alterations in cellular metabolism from causes such as hypoxia, changes in ATP, sene...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AMPK alpha 2 Antibody and receive a gift card or discount.


Gene Symbol PRKAA2